DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cora and EPB41L4A

DIOPT Version :9

Sequence 1:NP_523791.2 Gene:cora / 37205 FlyBaseID:FBgn0010434 Length:1698 Species:Drosophila melanogaster
Sequence 2:NP_001334816.1 Gene:EPB41L4A / 64097 HGNCID:13278 Length:708 Species:Homo sapiens


Alignment Length:747 Identity:207/747 - (27%)
Similarity:327/747 - (43%) Gaps:164/747 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VTLLDGSLLDVSIDRKAI-----GRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSK 95
            |.|||.|.|.::..::.|     |..|::.:...:||:|.|||||.|...:....|||..|.:::
Human    15 VLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAE 79

  Fly    96 FFR-TDTWP---LTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQ 156
            ... .:|.|   |.|.:|||..:|.:|||:||||...|||:.|:|:|||||...|.|.||:|.:|
Human    80 HKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQ 144

  Fly   157 SEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGV 221
            ||:||||..: .|..|:.:::..|:|..|||:.:..:|||..||.|:||||:||..||.|.||||
Human   145 SELGDYDPYK-HTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGV 208

  Fly   222 DLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTI 286
            ||||.......:..||:...|::||::|.::.::.||:|.|:.:|...|.:::...:..  |::.
Human   209 DLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCN--ETSF 271

  Fly   287 GFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGS---TYRYKGRTQAE-STNTPVD 347
            .|:..:..|.|.|||..||||||||:...|..|.|:....|||   .:||.|||..: |.:..:.
Human   272 FFEARSKTACKHLWKCSVEHHTFFRMPENESNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQ 336

  Fly   348 RTPPKFNRTLSGARLTSRSMDALALAEKEKVARKSSTLDH------------------------- 387
            ...|..|.|.|.::...:.:.....||...::|.::.:::                         
Human   337 LPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIKIIAPSPVKSFKKAKNEN 401

  Fly   388 ---------------------------------------RGDRNADGDAHSRSPIKNKKEKDADK 413
                                                   |.:.:...|..|..|::.:|..::.:
Human   402 SPDTQRSKSHAPWEENGPQSGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGE 466

  Fly   414 EAKLREKKQKEK-------EEKERKEREKRELEEKKKAEKAAKAALAAGAAAGAAVNGNDELNDS 471
            ::.|:::::...       .|.|...||.|    ||:.....:..:...|....||....:  :.
Human   467 DSDLKQRRRSRSRCNTSSGSESENSNREYR----KKRNRIRQENDMVDSAPQWEAVLRRQK--EK 525

  Fly   472 NKSDKSSGRRGVGIFSSGRKSKSGSPSKDGKDKSGKDKDKEVGRLGLVVTSGLGDNQQDQ---NL 533
            |::|.::.|       |..:|:|.||....|::..|...||     ||..|||.:.|..:   ..
Human   526 NQADPNNRR-------SRHRSRSRSPDIQAKEELWKHIQKE-----LVDPSGLSEEQLKEIPYTK 578

  Fly   534 DEAARNAAKNRGSTTPGVTRQYEYAVDNDGNTS-----PTRKSYTPGGFRYDQDPNSRKSGADGQ 593
            .|...:..:.|.|.:|...|||..:..:||..|     .::....|      ..|.:|.|.|.|.
Human   579 IETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVP------PLPVTRSSDAQGS 637

  Fly   594 -----EQLSPTSQQKKIGLAFNYAPGNENALKETAEKLKAGQLSPRTQDKLNRGQLSPKSRAKLL 653
                 .|...||:.:|         |.|           .|.||      ||:. |...|...||
Human   638 GDATVHQGVQTSRPRK---------GRE-----------LGNLS------LNKA-LQKVSHNTLL 675

  Fly   654 QDPLL-------------SPTTRAKLQGSAVD 672
            .:.:|             |||:.|.:.||.::
Human   676 DEVILGLGWSAHEVMWTESPTSLAAVVGSGIN 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coraNP_523791.2 B41 34..224 CDD:214604 86/196 (44%)
FERM_N 36..98 CDD:286467 22/66 (33%)
FERM_M 116..224 CDD:278785 56/107 (52%)
FERM_C_4_1_family 219..312 CDD:270005 33/92 (36%)
FA 323..363 CDD:285894 13/43 (30%)
PQQ_2 829..>972 CDD:290097
4_1_CTD 1612..1698 CDD:283537
EPB41L4ANP_001334816.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.