DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cora and CG12075

DIOPT Version :9

Sequence 1:NP_523791.2 Gene:cora / 37205 FlyBaseID:FBgn0010434 Length:1698 Species:Drosophila melanogaster
Sequence 2:NP_001245582.1 Gene:CG12075 / 31815 FlyBaseID:FBgn0030065 Length:1006 Species:Drosophila melanogaster


Alignment Length:637 Identity:128/637 - (20%)
Similarity:208/637 - (32%) Gaps:172/637 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHP 225
            ||||:........:......:|.|:|.|       |.|..     |::.|.| ||||.     .|
  Fly   513 DYDAKFNRVMQQEQQQAAVNHQPAKLRD-------TDKYN-----EINRLLN-KKLAH-----EP 559

  Fly   226 AKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFE---QYESTIG 287
            .:|.:.               |.:|..|              |..:....||...   .::.|.|
  Fly   560 TRDRKS---------------RSRLDDN--------------HDDFDDSDPGSESLPLHHQQTQG 595

  Fly   288 FKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGS--TYRYKGRTQAESTNTPVDRTP 350
            ..:.:|:..:.|    .:...|....:    .|.::...:|:  ..||:.| ..|||   .:..|
  Fly   596 PPVHHHQRKENL----TDKQKFMEYTS----KKQQLLKNYGAGEDQRYRQR-YVEST---TEHLP 648

  Fly   351 PKFNRTLSGARLTSRSMDA-----LALAEKEKVARKSSTLDH---RGDRNADGDAHSRSPIKNKK 407
            | |:....|...||....|     .|:.....:.::::...|   ||||:     |.|       
  Fly   649 P-FDHPTGGGVTTSTGGSAGHNKYAAVHRGTDLGQRTTERRHDRDRGDRD-----HPR------- 700

  Fly   408 EKDADKEAKLREKKQKEKEEKERKEREKRELEEKKKAEKAAKAALAAGAAAGAAVNGNDELNDSN 472
              ||::|.:...::.:|........||...|...:..||..|   :.|.....|.....|.....
  Fly   701 --DAERERRRDHERDREHSRDRNPYREAESLPYIQSMEKMMK---STGMRYAEATPKTRERERER 760

  Fly   473 KSDKSSGRRGVGIFSSGRKSKSGSPSKDGKDK-SGKDKDKEVGRLGLVVTSGLGDNQQDQNLDEA 536
            :.|:....|...:..|.::.:    ..|.||| ...::...|.|...|      |.:...:.|..
  Fly   761 ERDRDRDYREPPVTQSSQRDR----FHDAKDKFRAMEQRPAVNRYPDV------DERDTPHRDPY 815

  Fly   537 ARNAAKNRGSTTPGVTRQYEYAVDNDGNTSPTRKSYTPGGFRYDQDPNSRKSGADGQEQLSPTSQ 601
            ..::.:.|||..|..|.: :::.:.:.....:.|| .|      :|.|..::.:.|:.:..|...
  Fly   816 RSSSRRRRGSVEPPSTYE-QWSEEEEPPVVISEKS-NP------RDLNRSRARSRGEWEPEPPRH 872

  Fly   602 QKKIGLAFNYAPGNENALKETAEKLKAGQLSPRTQDK---LNRGQLSPKSRAKLLQDPLLSPTTR 663
            .::                         .:..|.:|:   .||.|    ||     ||......|
  Fly   873 LER-------------------------SVRDRERDRDRDYNRDQ----SR-----DPYRHERER 903

  Fly   664 AKLQGSAVDAAAVPLSDSQKRSY---SPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNKEPGY 725
            .:..|.|           ..|.:   ..||.|....||. |..:....|.|..::|.......|.
  Fly   904 ERPGGRA-----------HSREFLQSVETKNPSTTGSGR-GHMERYPSPAATPIQSVDVGGSGGG 956

  Fly   726 VGPSKADVAAGLAGAAGSKKPGSP-TKTGKGAPGAAA----AAAAGAAGAAA 772
            .|      ..|.:||:.....|.| |:..||...:.|    |...|..|.||
  Fly   957 GG------GGGGSGASSGGNSGKPLTQMAKGYRHSYAEPVFARTGGRVGLAA 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coraNP_523791.2 B41 34..224 CDD:214604 17/62 (27%)
FERM_N 36..98 CDD:286467
FERM_M 116..224 CDD:278785 17/62 (27%)
FERM_C_4_1_family 219..312 CDD:270005 13/95 (14%)
FA 323..363 CDD:285894 11/41 (27%)
PQQ_2 829..>972 CDD:290097
4_1_CTD 1612..1698 CDD:283537
CG12075NP_001245582.1 PTB 12..120 CDD:269911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.