DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cora and Frmd6

DIOPT Version :9

Sequence 1:NP_523791.2 Gene:cora / 37205 FlyBaseID:FBgn0010434 Length:1698 Species:Drosophila melanogaster
Sequence 2:XP_006240213.1 Gene:Frmd6 / 257646 RGDID:727810 Length:622 Species:Rattus norvegicus


Alignment Length:469 Identity:84/469 - (17%)
Similarity:171/469 - (36%) Gaps:103/469 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTD--------------PRTWLDLEKPVS 94
            :.:.|:.|.:...::..:|..|.|.:...|||:.....:              |:.|   :|..|
  Rat    28 VSIIINVKILCHQLLVQVCDLLRLKDSHLFGLSVIQNNEHVYMELSQKLYKYCPKEW---KKEAS 89

  Fly    95 KFFRTD-TWPLT---------FAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHAL 149
            |..:.: ||.:.         |.|::|......:.:.|.||:....:|..:|..:.......:.|
  Rat    90 KVRQYEVTWGIDQFGPPMIIHFRVQYYVENGKLISDRIARYYYYWHLRKQVLHSQCVLREEAYFL 154

  Fly   150 LGSYLVQSEMGDY-----DAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHY 209
            |.::.:|:::|::     ..:.....||...:.::......:...:.::|:.....:.:||.|.|
  Rat   155 LAAFALQADLGNFKRKVHHGDYFEPEAYFPAWVVSKRGKDYILKHIPNMHRDQFALTASEAYLKY 219

  Fly   210 LENAKKL---AMYGVDLHPAKDSEGVD--IMLGVCASGLLVYR----DKLRINRFAWPKILKISY 265
            ::.|.:|   |::...|:  ||...|:  :.||:...|:.:::    :|..:..|.|..:.|:.:
  Rat   220 IKEAVRLDDVAIHYYRLY--KDKREVEGSLTLGLTMRGIQIFQNLEEEKQLLYDFPWTNVGKLVF 282

  Fly   266 KRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPV----------SK 320
            ....|  :|.|.........:.:.....|:...|......|..:..|   :||          .:
  Rat   283 VGKKF--EILPDGLPSARKLVYYTGCPTRSRHLLQLLSNSHRLYMNL---QPVLRHLRKQEENEE 342

  Fly   321 SKMFPVFGSTYRYKGRTQAESTNTPVDRTPPKFNRTLSGARLTSRSMDALALAEKEKVARKSSTL 385
            .|.:           |....|.|..:|..|.:.....||:  ::.||       |.|...:.||.
  Rat   343 KKQY-----------RESYISDNLDLDMDPLEKRSRASGS--SAGSM-------KHKRLSRHSTA 387

  Fly   386 DHRGDRNA--DGDAHSRSP---------IKNKKEK--------------DADKEAKLREKKQKEK 425
            .|.....:  :.|...|.|         :.::|.|              ..:...|.|.::..:.
  Rat   388 SHSSSHTSGIETDTKPRDPGPEDGYSGSVMHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDSQD 452

  Fly   426 EEKERKEREKRELE 439
            :|.|....:.|:||
  Rat   453 DEIEMLVDDPRDLE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coraNP_523791.2 B41 34..224 CDD:214604 37/211 (18%)
FERM_N 36..98 CDD:286467 13/67 (19%)
FERM_M 116..224 CDD:278785 19/115 (17%)
FERM_C_4_1_family 219..312 CDD:270005 17/98 (17%)
FA 323..363 CDD:285894 7/39 (18%)
PQQ_2 829..>972 CDD:290097
4_1_CTD 1612..1698 CDD:283537
Frmd6XP_006240213.1 B41 20..234 CDD:214604 37/208 (18%)
FERM_N 20..82 CDD:286467 8/53 (15%)
FERM_M 123..234 CDD:278785 19/110 (17%)
FERM_C_FRMD1_FRMD6 227..335 CDD:270006 21/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.