DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cora and FRMD3

DIOPT Version :9

Sequence 1:NP_523791.2 Gene:cora / 37205 FlyBaseID:FBgn0010434 Length:1698 Species:Drosophila melanogaster
Sequence 2:NP_777598.3 Gene:FRMD3 / 257019 HGNCID:24125 Length:597 Species:Homo sapiens


Alignment Length:494 Identity:154/494 - (31%)
Similarity:245/494 - (49%) Gaps:81/494 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSSSSHGKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWL 87
            ||..|..:.....:.|||.|.:...|.|:..|:.:|:.||...:|:||||||:.|..|...|.||
Human    23 SSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWL 87

  Fly    88 DLEKPVSKFFRT-DTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLG 151
            :..|.:.|..:| ..:.:.|.|||||.||.::||::|||.|.||::.||..|||.|:|...|.||
Human    88 EPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLG 152

  Fly   152 SYLVQSEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTH-KGQSPAEAELHYLENAKK 215
            :.:||:|:||||.:|.|.. |:.:|:|.|.|:.:||.|::::||.. :||||..||.:.|..|..
Human   153 ACIVQAELGDYDPDEHPEN-YISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHT 216

  Fly   216 LAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFE 280
            |..||||.||.|||.|....||..|:|.:|::...||:...||.:.|:.::...||:   .|..:
Human   217 LETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYV---IGTQK 278

  Fly   281 QYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTP---EPVSKSKMFPVFGSTYRYKGRTQAE-- 340
            :.::.:.|..:...|.|.|||..||:..|::....   :.||.||:| ..||.:||.|:...|  
Human   279 EKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIF-FKGSRFRYSGKVAKEVV 342

  Fly   341 STNTPVDRTPPKFNRTLSGARLT-SRSMDAL----------------ALAEKEKVARKSSTLDHR 388
            ..::.:.|.||:.:|    |.:| |||..:|                :.:|:|:.......:...
Human   343 EASSKIQREPPEVHR----ANITQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLP 403

  Fly   389 GDRNADGDAHSRSPIKNKKEKD---ADKEAKLRE------------------------------- 419
            .:.|......|.||:|..:|.:   :::|.|::|                               
Human   404 KEENISAPLISSSPVKAAREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFD 468

  Fly   420 ---KKQKEKEEKERKE-----------REKRELEEKKKA 444
               :.:.|:|:.:..|           .|:.||:|.::|
Human   469 CPSRLELEREDTDSFEDLEADENAFLIAEEEELKEARRA 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coraNP_523791.2 B41 34..224 CDD:214604 83/191 (43%)
FERM_N 36..98 CDD:286467 24/61 (39%)
FERM_M 116..224 CDD:278785 50/108 (46%)
FERM_C_4_1_family 219..312 CDD:270005 32/92 (35%)
FA 323..363 CDD:285894 12/41 (29%)
PQQ_2 829..>972 CDD:290097
4_1_CTD 1612..1698 CDD:283537
FRMD3NP_777598.3 B41 33..225 CDD:214604 83/192 (43%)
FERM_N 36..98 CDD:286467 24/61 (39%)
FERM_M 117..225 CDD:278785 50/108 (46%)
PH-like 206..309 CDD:302622 37/105 (35%)
FA 323..>357 CDD:285894 11/34 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..403 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.