DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cora and M88.4

DIOPT Version :9

Sequence 1:NP_523791.2 Gene:cora / 37205 FlyBaseID:FBgn0010434 Length:1698 Species:Drosophila melanogaster
Sequence 2:NP_497922.2 Gene:M88.4 / 175594 WormBaseID:WBGene00010907 Length:365 Species:Caenorhabditis elegans


Alignment Length:241 Identity:48/241 - (19%)
Similarity:86/241 - (35%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 SKDGKDKSGKDKDKEVGRLGLVV--TSGLGDNQQDQNLDEAARNAAKNR--GSTTPGVTRQYEYA 558
            |:....:|..|.:..:...||:|  .:...:...:||.....|:.:::|  ..:|.|.       
 Worm   144 SRPDVQRSINDLEHRLFLSGLLVPRNNNNSEGSVNQNALRPQRSCSQSRSVSRSTAGF------- 201

  Fly   559 VDNDGNTSPTRKSYTPGGFRYDQDPNSRKSGADG-QEQLSPTSQQKKIGLAFNYAPGNENALKET 622
               |..:||           .::|..||.:..|. ..:|:||..::.:....|...|..      
 Worm   202 ---DERSSP-----------LERDQRSRTTDIDAPPRRLAPTISRRVVDELKNKIIGES------ 246

  Fly   623 AEKLKAGQLSPRTQDKLNRGQLSPKSRAKLLQDPLLSPTTRAKLQGSAV------------DAAA 675
                :.|.:|...:..|||  ...:.||.|.:.|:.:.::|.::.|..:            |.||
 Worm   247 ----RIGNMSRSRESSLNR--YESEKRASLSELPIETDSSRYRMFGDTMLRDTKNKSRSLDDLAA 305

  Fly   676 VPLSDSQKRSYSPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNK 721
            .||..:..|.......|       |..: |.|:..||......|.:
 Worm   306 DPLVSTNLRGSDLAPPP-------PRRF-PRSEYVADPFGHNSYER 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coraNP_523791.2 B41 34..224 CDD:214604
FERM_N 36..98 CDD:286467
FERM_M 116..224 CDD:278785
FERM_C_4_1_family 219..312 CDD:270005
FA 323..363 CDD:285894
PQQ_2 829..>972 CDD:290097
4_1_CTD 1612..1698 CDD:283537
M88.4NP_497922.2 PTB 13..152 CDD:214675 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.