DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cora and frmd3

DIOPT Version :9

Sequence 1:NP_523791.2 Gene:cora / 37205 FlyBaseID:FBgn0010434 Length:1698 Species:Drosophila melanogaster
Sequence 2:XP_002663277.2 Gene:frmd3 / 100331256 ZFINID:ZDB-GENE-070523-1 Length:603 Species:Danio rerio


Alignment Length:422 Identity:150/422 - (35%)
Similarity:228/422 - (54%) Gaps:25/422 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFR-T 99
            |.|||.|.:..||.|...|:.:::.:|...:|:||||||:.|..|...|.|||..|||.|..: .
Zfish    22 VRLLDDSEISCSIQRDTKGQFLVDHVCNHYSLLEKDYFGIRYVDPDKQRHWLDPSKPVVKQMKCQ 86

  Fly   100 DTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDA 164
            ..:.:.|.|||||.||.::||::|||.|.||::.|:..|||.|.|...|.||:.:||:|:||||.
Zfish    87 QPYTMCFRVKFYPQEPIKIKEELTRYLLYLQLKRDVYHGRLLCPFADAAYLGACIVQAELGDYDP 151

  Fly   165 EEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTH-KGQSPAEAELHYLENAKKLAMYGVDLHPAKD 228
            ||.|. .|:.|||:.|.|:.:||.|:|::|:.. :||.|:.|||:.|:.|..|..||||.||.||
Zfish   152 EEHPA-DYISDFKLFPKQSLKLERKIMEIHQNELRGQCPSLAELNLLQRAHTLDTYGVDPHPCKD 215

  Fly   229 SEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANH 293
            ..|....||..|.|.:|::...||:...|..:.|..::...||:   .|...:.:..:.|..:..
Zfish   216 FTGSTAFLGFTARGFVVFQGNKRIHLLKWADVSKFKFEGKTFYV---IGVQREKKLVLTFHTSTP 277

  Fly   294 RAAKKLWKSCVEHHTFFRLMTP---EPVSKSKMFPVFGSTYRYKGRTQAE--STNTPVDRTPPKF 353
            .|.|.|||..||:..|::....   :.||.|.:| ..||.:||.||...|  ..::.:.|.||..
Zfish   278 AACKHLWKCGVENQAFYK
CAKSSQIKTVSSSSIF-FKGSRFRYSGRVAKEVIEASSKIQRDPPVV 341

  Fly   354 NRTLSG--ARLTSRSMDALALAEKEKVARKSSTLDHRGDRNADG------DAHSRSPIK-NKKEK 409
            :|...|  ...||.|...|.:..:..:...||:.:.| |.:||.      |....||:| :...:
Zfish   342 HRCQFGQSRSFTSLSHKQLIMNMEPLLPALSSSRESR-DSSADNGLSALKDCVHLSPLKPSVTPE 405

  Fly   410 DADKEAKL---REKKQKEKEEKERKEREKREL 438
            :|:.|..|   :|:::.|..::.|.:.::||:
Zfish   406 EAEMEEMLNFSQERREDEASQRTRVDEDRREI 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coraNP_523791.2 B41 34..224 CDD:214604 86/189 (46%)
FERM_N 36..98 CDD:286467 27/61 (44%)
FERM_M 116..224 CDD:278785 51/108 (47%)
FERM_C_4_1_family 219..312 CDD:270005 30/92 (33%)
FA 323..363 CDD:285894 13/43 (30%)
PQQ_2 829..>972 CDD:290097
4_1_CTD 1612..1698 CDD:283537
frmd3XP_002663277.2 B41 20..211 CDD:214604 86/189 (46%)
FERM_N 22..85 CDD:286467 27/62 (44%)
FERM_M 104..211 CDD:278785 51/107 (48%)
PH-like 192..295 CDD:302622 36/105 (34%)
FA 310..356 CDD:285894 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.