DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and STK24

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_016876283.1 Gene:STK24 / 8428 HGNCID:11403 Length:517 Species:Homo sapiens


Alignment Length:471 Identity:173/471 - (36%)
Similarity:242/471 - (51%) Gaps:105/471 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPS-DDIQIIQQEIIMMRDCRHPN 82
            :.:|::.:..::|||.|::|:|:|....::.::.|||:|.||.: |:|:.|||||.::..|..|.
Human   103 KADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPY 167

  Fly    83 IIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDI 147
            :..||||||:..||||.||:.||||..|:.: .|||.|.|||.:.||.||||:||||..|:||||
Human   168 VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLDYLHSEKKIHRDI 231

  Fly   148 KGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGI 212
            |.||:||:|:|:||||||||:.|:|.|..||.:|:|||:||||||.   ::..|:...|||:.||
Human   232 KAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI---KQSAYDSKADIWSLGI 293

  Fly   213 TAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERL 277
            ||||||..:||..:||||:.|||:.|:  .||||  :..:|.....|::..|.|.|..||||:.|
Human   294 TAIELARGEPPHSELHPMKVLFLIPKN--NPPTL--EGNYSKPLKEFVEACLNKEPSFRPTAKEL 354

  Fly   278 LQHPFVQCEMSLRVAK------ELLQKYQSPNPQFYYYLDGDEESVAGVPQRIASKMTSRTNGVP 336
            |:|.|:     ||.||      ||:.:|:....:..:.....|:|.|            .|:|  
Human   355 LKHKFI-----LRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDA------------ETDG-- 400

  Fly   337 AQNHTLKTGMTTNSTW--NERSSSPETL------PSDMSLLQYIDEELKLRATLPLNNDTKD--- 390
                 ..:|.:.:..|  ..|...|:.|      |||:.                 .|..||   
Human   401 -----QASGGSDSGDWIFTIREKDPKNLENGALQPSDLD-----------------RNKMKDIPK 443

  Fly   391 ------------PLGAECSCSSHNGGAAGGGGGGGV-----GVGAGGAAANGSS----------- 427
                        ||.||....|.    |.||..|.:     .:.....|..|.|           
Human   444 RPFSQCLSTIISPLFAELKEKSQ----ACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRL 504

  Fly   428 ---SSSGGATVGTTHH 440
               |.|||   ||:.|
Human   505 QRYSLSGG---GTSSH 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 129/258 (50%)
S_TKc 26..283 CDD:214567 129/257 (50%)
CNH 869..1184 CDD:279162
STK24XP_016876283.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.