DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and NP1

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_563832.2 Gene:NP1 / 837421 AraportID:AT1G09000 Length:666 Species:Arabidopsis thaliana


Alignment Length:421 Identity:124/421 - (29%)
Similarity:189/421 - (44%) Gaps:65/421 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QKIGSGTYGDVYKAKRIQSNELAAIKVI--------KLEPSDDIQIIQQEIIMMRDCRHPNIIAY 86
            |.||.|.:|.||....:.|.||.|:|.:        |.:....||.:::|:.::::..||||:.|
plant    73 QLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKLLKNLSHPNIVRY 137

  Fly    87 YGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGAN 151
            .|:....|.|.|.:||..|||:..:.:..||..|..:....|:.|.||||||:...|||||||||
plant   138 LGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDIKGAN 202

  Fly   152 ILLTEYGDVKLADFGVSAQIT--ATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITA 214
            ||:...|.:||||||.|.|:.  ||:...||..||||||||||..   :.|::...|||:.|.|.
plant   203 ILVDNKGCIKLADFGASKQVAELATMTGAKSMKGTPYWMAPEVIL---QTGHSFSADIWSVGCTV 264

  Fly   215 IELAELQPPMFDLH-PMRALFLMSKSGFKPP---TLNNKDKWSPTFHNFIKTALTKNPKKRPTAE 275
            ||:...:.|....: .:.|:|.:..:...||   ||::..|      :|:...|.:.|..||||.
plant   265 IEMVTGKAPWSQQYKEVAAIFFIGTTKSHPPIPDTLSSDAK------DFLLKCLQEVPNLRPTAS 323

  Fly   276 RLLQHPFVQCEMSLRVAKEL---LQKYQSPNPQFYYYLDGDEESVAGVPQRIASKMTSRTNGVPA 337
            .||:||||..:.....:.:|   |....:|.|.       ...:....|......:....| ..:
plant   324 ELLKHPFVMGKHKESASTDLGSVLNNLSTPLPL-------QINNTKSTPDSTCDDVGDMCN-FGS 380

  Fly   338 QNHTL---KTGMTTNSTWNERSSSPE---------------------TLPSDMSLLQYIDEELKL 378
            .|::|   ...:...:.|.:..:..:                     ||..|..|.:..|:...:
plant   381 LNYSLVDPVKSIQNKNLWQQNDNGGDEDDMCLIDDENFLTFDGEMSSTLEKDCHLKKSCDDISDM 445

  Fly   379 RATL-------PLNNDTKDPLGAECSCSSHN 402
            ...|       |.|.:.:..:..||...|::
plant   446 SIALKSKFDESPGNGEKESTMSMECDQPSYS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 102/266 (38%)
S_TKc 26..283 CDD:214567 102/266 (38%)
CNH 869..1184 CDD:279162
NP1NP_563832.2 STKc_MAPKKK 68..331 CDD:270783 102/266 (38%)
S_TKc 69..331 CDD:214567 102/266 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.