DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and AT4G14480

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_193184.1 Gene:AT4G14480 / 827095 AraportID:AT4G14480 Length:487 Species:Arabidopsis thaliana


Alignment Length:331 Identity:124/331 - (37%)
Similarity:162/331 - (48%) Gaps:49/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DEYELIQKIGSGTYGDVYKAKRIQSNEL-AAIKVIKLEPS-DDIQIIQQEIIMMRDCRHPNIIAY 86
            :.||:|.|||.|....||||..|..|.: .|||.|.|:.| .|...:::|...|....||||:..
plant    13 EAYEIICKIGVGVSASVYKAICIPMNSMVVAIKAIDLDQSRADFDSLRRETKTMSLLSHPNILNA 77

  Fly    87 YGSYLRRDKLWICMEFCGGGSLQDIYQVTGP--LTEVQIAYMCRETLKGLEYLHSMGKMHRDIKG 149
            |.|:.....||:.|.|...|||..|...:.|  |.|..|:...:|||..:.|||..|.:|||||.
plant    78 YCSFTVDRCLWVVMPFMSCGSLHSIVSSSFPSGLPENCISVFLKETLNAISYLHDQGHLHRDIKA 142

  Fly   150 ANILLTEYGDVKLADFGVSAQI----------TATINKRKSFIGTPYWMAPEVAAVERKGGYNQL 204
            .|||:...|.||||||||||.|          |::..:.....||||||||||  |....||...
plant   143 GNILVDSDGSVKLADFGVSASIYEPVTSSSGTTSSSLRLTDIAGTPYWMAPEV--VHSHTGYGFK 205

  Fly   205 CDIWACGITAIELAELQPPMFDLHPMRALFL-----------------MSKSGFKPPTLNNKDKW 252
            .|||:.||||:|||..:||:..|.|:::|.:                 .||.|.|        |:
plant   206 ADIWSFGITALELAHGRPPLSHLPPLKSLLMKITKRFHFSDYEINTSGSSKKGNK--------KF 262

  Fly   253 SPTFHNFIKTALTKNPKKRPTAERLLQHPFVQ-CEMSLRVAKELLQKYQSPNPQFYYYL------ 310
            |..|...:...|.::|.|||:||:||:|||.: |:....|.|.:|....:....|....      
plant   263 SKAFREMVGLCLEQDPTKRPSAEKLLKHPFFKNCKGLDFVVKNVLHSLSNAEQMFMESQILIKSV 327

  Fly   311 -DGDEE 315
             |.|||
plant   328 GDDDEE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 114/288 (40%)
S_TKc 26..283 CDD:214567 114/287 (40%)
CNH 869..1184 CDD:279162
AT4G14480NP_193184.1 STKc_OSR1_SPAK 13..293 CDD:270787 114/289 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.