DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and MAPKKK9

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_192588.1 Gene:MAPKKK9 / 826407 AraportID:AT4G08480 Length:773 Species:Arabidopsis thaliana


Alignment Length:287 Identity:100/287 - (34%)
Similarity:147/287 - (51%) Gaps:27/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SSDISRRNP--------QDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKL-----EPSDDI 65
            ||.:|..:|        ...::..|.:..|::|.||:|.. :..:..|:|.:.|     :..:.|
plant   481 SSTVSNTSPICVSGGSINTSWQKGQLLRQGSFGSVYEAIS-EDGDFFAVKEVSLLDQGSQAQECI 544

  Fly    66 QIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDI---YQVTGPLTEVQIAYMC 127
            |.::.||.::....|.||:.|.|:......|:|.:|....|||.::   ||:...|    |:...
plant   545 QQLEGEIALLSQLEHQNILRYRGTDKDGSNLYIFLELVTQGSLLELYRRYQIRDSL----ISLYT 605

  Fly   128 RETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEV 192
            ::.|.||:|||..|.:|||||.|.||:...|.|||||||::.  .:.:|..||...|.:||||||
plant   606 KQILDGLKYLHHKGFIHRDIKCATILVDANGTVKLADFGLAK--VSKLNDIKSRKETLFWMAPEV 668

  Fly   193 AAVERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFH 257
            ...:...||....|||:.|.|.:|:...|.|..||.|:.|||.: :.|..|..   .|..|....
plant   669 INRKDNDGYRSPADIWSLGCTVLEMCTGQIPYSDLEPVEALFRI-RRGTLPEV---PDTLSLDAR 729

  Fly   258 NFIKTALTKNPKKRPTAERLLQHPFVQ 284
            :||...|..||::||||..||.||||:
plant   730 HFILKCLKLNPEERPTATELLNHPFVR 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 94/265 (35%)
S_TKc 26..283 CDD:214567 94/264 (36%)
CNH 869..1184 CDD:279162
MAPKKK9NP_192588.1 PKc_like 500..755 CDD:304357 94/265 (35%)
S_TKc 501..755 CDD:214567 94/264 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.