DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and STK4

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_005260587.1 Gene:STK4 / 6789 HGNCID:11408 Length:503 Species:Homo sapiens


Alignment Length:399 Identity:158/399 - (39%)
Similarity:237/399 - (59%) Gaps:45/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRD 77
            |..|...:.|::.:::::|:|.|:||.||||...::.::.|||.:.:|  .|:|.|.:||.:|:.
Human    33 LDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVE--SDLQEIIKEISIMQQ 95

  Fly    78 CRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTG-PLTEVQIAYMCRETLKGLEYLHSMG 141
            |..|:::.|||||.:...|||.||:||.||:.||.::.. .|||.:||.:.:.|||||||||.|.
Human    96 CDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMR 160

  Fly   142 KMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCD 206
            |:|||||..||||...|..|||||||:.|:|.|:.||.:.||||:||||||.   ::.|||.:.|
Human   161 KIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI---QEIGYNCVAD 222

  Fly   207 IWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKR 271
            ||:.||||||:||.:||..|:|||||:|::..:  .|||....:.||..|.:|:|..|.|:|::|
Human   223 IWSLGITAIEMAEGKPPYADIHPMRAIFMIPTN--PPPTFRKPELWSDNFTDFVKQCLVKSPEQR 285

  Fly   272 PTAERLLQHPFVQCEMSLRVAKEL--------LQKYQSPNPQFYYYLDGDEES------------ 316
            .||.:|||||||:....:.:.::|        |::.:|...:    :|.|:|.            
Human   286 ATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQRE----VDQDDEENSEEDEMDSGTM 346

  Fly   317 VAGVPQ-----RIASKMTSRTNGVPAQNHTLKTGMTT---NSTWNERSSS----PETL-PSDMSL 368
            |..|..     |:||.||...|.:...:.||.:.:.|   |:...|...:    .||: |:..|.
Human   347 VRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSF 411

  Fly   369 LQYIDEELK 377
            |:|.:::.|
Human   412 LEYFEQKEK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 127/258 (49%)
S_TKc 26..283 CDD:214567 127/257 (49%)
CNH 869..1184 CDD:279162
STK4XP_005260587.1 STKc_MST1_2 42..297 CDD:132943 128/261 (49%)
S_TKc 46..297 CDD:214567 127/257 (49%)
Mst1_SARAH 449..496 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.