DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and STK3

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_016869245.1 Gene:STK3 / 6788 HGNCID:11406 Length:580 Species:Homo sapiens


Alignment Length:426 Identity:156/426 - (36%)
Similarity:236/426 - (55%) Gaps:61/426 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRD 77
            ||.|...:.|::.:::::|:|.|:||.|:||...:|.::.|||.:.:|  .|:|.|.:||.:|:.
Human    99 LSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVE--SDLQEIIKEISIMQQ 161

  Fly    78 CRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTG-PLTEVQIAYMCRETLKGLEYLHSMG 141
            |..|.::.|||||.:...|||.||:||.||:.||.::.. .|.|.:||.:.:.|||||||||.|.
Human   162 CDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMR 226

  Fly   142 KMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCD 206
            |:|||||..||||...|..|||||||:.|:|.|:.||.:.||||:||||||.   ::.|||.:.|
Human   227 KIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI---QEIGYNCVAD 288

  Fly   207 IWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKR 271
            ||:.|||:||:||.:||..|:|||||:|::..:  .|||....:.||..|.:|:|..|.|||::|
Human   289 IWSLGITSIEMAEGKPPYADIHPMRAIFMIPTN--PPPTFRKPELWSDDFTDFVKKCLVKNPEQR 351

  Fly   272 PTAERLLQHPFVQCEMSLRVAKELL--------QKYQSPNPQFYYYLDGDEE------------- 315
            .||.:||||||::....:.:.::|:        ::::....:    |:.:||             
Human   352 ATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRE----LEEEEENSDEDELDSHTMV 412

  Fly   316 --SVAGV-PQRIASKMTSRTNGVPAQNHTLKTG----MTTNS--------TWNERSSSPETLPSD 365
              ||..| ..|..|.|:.....:...|.|:...    |..||        |....::||:.  ..
Human   413 KTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQV--QR 475

  Fly   366 MSLLQYIDEELKLRATLPLNNDTKDPLGAECSCSSH 401
            .|.:.|.|::           |.|:.....|:.:.|
Human   476 PSFMDYFDKQ-----------DFKNKSHENCNQNMH 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 126/258 (49%)
S_TKc 26..283 CDD:214567 126/257 (49%)
CNH 869..1184 CDD:279162
STK3XP_016869245.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.