DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and PAK5

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_065074.1 Gene:PAK5 / 57144 HGNCID:15916 Length:719 Species:Homo sapiens


Alignment Length:284 Identity:107/284 - (37%)
Similarity:162/284 - (57%) Gaps:6/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHP 81
            :|..:|::......|||.|:.|.|..|....:.:..|:|.:.|......:::..|:::|||..|.
Human   440 VSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHD 504

  Fly    82 NIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRD 146
            |::..|.|||..|:||:.|||..||:|.||...| .:.|.|||.:|...|:.|.|||:.|.:|||
Human   505 NVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHT-RMNEEQIATVCLSVLRALSYLHNQGVIHRD 568

  Fly   147 IKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACG 211
            ||..:||||..|.:||:|||..||::..:.||||.:||||||||||.:   :..|....|||:.|
Human   569 IKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVIS---RLPYGTEVDIWSLG 630

  Fly   212 ITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAER 276
            |..||:.:.:||.|:..|::|:..:..|  .||.:.:..|.|.....|:...|.:.|.:|.||:.
Human   631 IMVIEMIDGEPPYFNEPPLQAMRRIRDS--LPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQE 693

  Fly   277 LLQHPFVQCEMSLRVAKELLQKYQ 300
            ||.|||::..........|:::|:
Human   694 LLGHPFLKLAGPPSCIVPLMRQYR 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 102/257 (40%)
S_TKc 26..283 CDD:214567 102/256 (40%)
CNH 869..1184 CDD:279162
PAK5NP_065074.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
CRIB_PAK_like 9..55 CDD:238526
Linker 25..448 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..373
STKc_PAK5 426..717 CDD:132989 106/282 (38%)
S_TKc 454..700 CDD:214567 102/251 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.