DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and PAK6

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001263646.1 Gene:PAK6 / 56924 HGNCID:16061 Length:681 Species:Homo sapiens


Alignment Length:254 Identity:110/254 - (43%)
Similarity:156/254 - (61%) Gaps:8/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDK 95
            |||.|:.|.|..|:...|....|:|::.|......:::..|:::|||.:|.|::..|.|||..::
Human   412 KIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEE 476

  Fly    96 LWICMEFCGGGSLQDIY-QVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGD 159
            ||:.|||..||:|.||. ||.  |.|.|||.:|...|:.|.|||:.|.:|||||..:||||..|.
Human   477 LWVLMEFLQGGALTDIVSQVR--LNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGR 539

  Fly   160 VKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITAIELAELQPPM 224
            |||:|||..|||:..:.||||.:||||||||||.:   :..|....|||:.||..||:.:.:||.
Human   540 VKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVIS---RSLYATEVDIWSLGIMVIEMVDGEPPY 601

  Fly   225 FDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFV 283
            |...|::|:..:..|  .||.|.|..|.||...:|::..|.::|::|.||:.||.|||:
Human   602 FSDSPVQAMKRLRDS--PPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFL 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 109/252 (43%)
S_TKc 26..283 CDD:214567 109/252 (43%)
CNH 869..1184 CDD:279162
PAK6NP_001263646.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PBD 11..67 CDD:307091
Linker 26..406
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..169
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..256
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..355
STKc_PAK6 385..681 CDD:270821 110/254 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.