DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and pak6b

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001155959.1 Gene:pak6b / 567874 ZFINID:ZDB-GENE-041014-121 Length:607 Species:Danio rerio


Alignment Length:285 Identity:115/285 - (40%)
Similarity:165/285 - (57%) Gaps:8/285 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAAHSHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQ 66
            :..|:...| .|...:...:|:...|...|||.|:.|.|..|:...|....|:|::.|......:
Zfish   310 SVTHTQFRA-ALQMVVDPGDPRSYLENFIKIGEGSTGVVCIAREKHSGRQVAVKMMDLRKQQRRE 373

  Fly    67 IIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETL 131
            ::..|:::|||.||.|::..|.|.|..::||:.||:..||:|.:|...| .|||.|||.:|...|
Zfish   374 LLFNEVVIMRDYRHQNVVEMYKSALVGEELWVIMEYLQGGALTNIVSET-RLTEEQIATVCESVL 437

  Fly   132 KGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVE 196
            :.|.||||.|.:|||||..:||||..|.|||:|||..|||:..:.||:|.:||||||||||.:  
Zfish   438 QALCYLHSQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKRRSLVGTPYWMAPEVVS-- 500

  Fly   197 RKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIK 261
             |..|....|||:.||..:|:.:.:||.|...|:.|:..:...  .|||..|..|.||...:|:.
Zfish   501 -KTPYGTEVDIWSLGIMVVEMVDGEPPYFSETPISAMKRLRDE--PPPTARNASKISPVLRDFLD 562

  Fly   262 TALTKNPKKRPTAERLLQHPF-VQC 285
            :.||:.|::|.:|..|||||| :||
Zfish   563 SMLTREPQQRSSASDLLQHPFLLQC 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 109/258 (42%)
S_TKc 26..283 CDD:214567 109/257 (42%)
CNH 869..1184 CDD:279162
pak6bNP_001155959.1 PBD 13..65 CDD:279166
STKc_PAK6 311..607 CDD:270821 115/284 (40%)
S_TKc 338..584 CDD:214567 107/251 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.