DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and STK26

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_057626.2 Gene:STK26 / 51765 HGNCID:18174 Length:416 Species:Homo sapiens


Alignment Length:315 Identity:142/315 - (45%)
Similarity:204/315 - (64%) Gaps:17/315 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPS-DDIQIIQQEIIMMRDCRHPNII 84
            :|::.:..:::||.|::|:|:|....::.::.|||:|.||.: |:|:.|||||.::..|....:.
Human    19 DPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVT 83

  Fly    85 AYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKG 149
            .||||||:..||||.||:.||||..|:.: .||..|.|||.|.:|.||||:||||..|:|||||.
Human    84 KYYGSYLKGSKLWIIMEYLGGGSALDLLR-AGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKA 147

  Fly   150 ANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITA 214
            ||:||:|.||||||||||:.|:|.|..||.:|:|||:||||||.   ::..|:...|||:.||||
Human   148 ANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI---QQSAYDSKADIWSLGITA 209

  Fly   215 IELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQ 279
            ||||:.:||..|:||||.|||:.|:  .||||  ...::.:|..||...|.|:|..||||:.||:
Human   210 IELAKGEPPNSDMHPMRVLFLIPKN--NPPTL--VGDFTKSFKEFIDACLNKDPSFRPTAKELLK 270

  Fly   280 HPF-VQCEMSLRVAKELLQKYQSPNPQFYYYLDGDEESVAGVPQRIASKMTSRTN 333
            |.| |:.........||:.:::....:.:    .|:||.:   :...|:.|||.|
Human   271 HKFIVKNSKKTSYLTELIDRFKRWKAEGH----SDDESDS---EGSDSESTSREN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 130/259 (50%)
S_TKc 26..283 CDD:214567 130/258 (50%)
CNH 869..1184 CDD:279162
STK26NP_057626.2 STKc_MST4 19..295 CDD:132971 134/283 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..340 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.