DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and PAK3

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001121640.1 Gene:PAK3 / 5063 HGNCID:8592 Length:580 Species:Homo sapiens


Alignment Length:283 Identity:125/283 - (44%)
Similarity:175/283 - (61%) Gaps:12/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRD 77
            |.|.:|..:|:.:|...:|||.|..|.||.|..|.:.:..|||.:.|:.....::|..||::||:
Human   291 LRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRE 355

  Fly    78 CRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGK 142
            .::|||:.|..|||..|:||:.||:..||||.|:...| .:.|.|||.:|||.|:.|::|||...
Human   356 NKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTET-CMDEGQIAAVCRECLQALDFLHSNQV 419

  Fly   143 MHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDI 207
            :|||||..||||...|.|||.|||..||||...:||.:.:||||||||||  |.|| .|....||
Human   420 IHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV--VTRK-AYGPKVDI 481

  Fly   208 WACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRP 272
            |:.||.|||:.|.:||..:.:|:|||:|::.:|  .|.|.|.::.|..|.:|:...|..:..:|.
Human   482 WSLGIMAIEMVEGEPPYLNENPLRALYLIATNG--TPELQNPERLSAVFRDFLNRCLEMDVDRRG 544

  Fly   273 TAERLLQHPFVQCEMSLRVAKEL 295
            :|:.||||||      |::||.|
Human   545 SAKELLQHPF------LKLAKPL 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 116/257 (45%)
S_TKc 26..283 CDD:214567 116/256 (45%)
CNH 869..1184 CDD:279162
PAK3NP_001121640.1 PBD 69..162 CDD:307091
STKc_PAK3 284..580 CDD:132987 125/283 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.