DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and PAK1

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001122092.1 Gene:PAK1 / 5058 HGNCID:8590 Length:553 Species:Homo sapiens


Alignment Length:267 Identity:120/267 - (44%)
Similarity:167/267 - (62%) Gaps:6/267 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRD 77
            |.|.:|..:|:.:|...:|||.|..|.||.|..:.:.:..|||.:.|:.....::|..||::||:
Human   257 LRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRE 321

  Fly    78 CRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGK 142
            .::|||:.|..|||..|:||:.||:..||||.|:...| .:.|.|||.:|||.|:.||:|||...
Human   322 NKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTET-CMDEGQIAAVCRECLQALEFLHSNQV 385

  Fly   143 MHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDI 207
            :|||||..||||...|.|||.|||..||||...:||.:.:||||||||||  |.|| .|....||
Human   386 IHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV--VTRK-AYGPKVDI 447

  Fly   208 WACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRP 272
            |:.||.|||:.|.:||..:.:|:|||:|::.:|  .|.|.|.:|.|..|.:|:...|..:.:||.
Human   448 WSLGIMAIEMIEGEPPYLNENPLRALYLIATNG--TPELQNPEKLSAIFRDFLNRCLEMDVEKRG 510

  Fly   273 TAERLLQ 279
            :|:.|||
Human   511 SAKELLQ 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 116/255 (45%)
S_TKc 26..283 CDD:214567 116/254 (46%)
CNH 869..1184 CDD:279162
PAK1NP_001122092.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Autoregulatory region 70..140
PBD 74..128 CDD:334253
GTPase-binding 75..105
Interaction with CRIPAK. /evidence=ECO:0000269|PubMed:16278681 132..270 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..251
STKc_PAK_I 262..517 CDD:270814 116/260 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.