DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and Myo3a

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_574090.6 Gene:Myo3a / 498806 RGDID:1560083 Length:268 Species:Rattus norvegicus


Alignment Length:235 Identity:106/235 - (45%)
Similarity:154/235 - (65%) Gaps:19/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDI-QIIQQEIIMMRDCR-HPNI 83
            :|.|.:|:.:.||.||||.|:|....::.:.||:|:  |:|..|| :.|:.|..::|... |||:
  Rat    16 DPSDTWEITETIGKGTYGKVFKVLNKKNGQKAAVKI--LDPIHDIDEEIEAEYNILRTLSDHPNV 78

  Fly    84 IAYYGSYLRR-----DKLWICMEFCGGGSLQDIYQVTG------PLTEVQIAYMCRETLKGLEYL 137
            :.:||.|.::     ||||:.:|.|.|||:.|:  |.|      .::|..|||:..|.|.||::|
  Rat    79 VRFYGIYFKKDKINGDKLWLVLELCNGGSVTDL--VKGFLKRGERMSEPIIAYILHEALMGLQHL 141

  Fly   138 HSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERK--GG 200
            ||...:|||:||.|||||..|.|||.|||||||:::|.::..:.:|||:||||||.|.|::  ..
  Rat   142 HSNKTIHRDVKGNNILLTTEGGVKLVDFGVSAQLSSTRHRLNTSVGTPFWMAPEVIACEQQLDTT 206

  Fly   201 YNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSG 240
            |:..||.|:.|||||||.:..||:.:||||||||.:.:||
  Rat   207 YDARCDTWSLGITAIELGDGDPPLAELHPMRALFKIPRSG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 104/231 (45%)
S_TKc 26..283 CDD:214567 104/230 (45%)
CNH 869..1184 CDD:279162
Myo3aXP_574090.6 PKc_like 2..258 CDD:419665 106/235 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.