DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and stk25a

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_005165982.1 Gene:stk25a / 449653 ZFINID:ZDB-GENE-041010-92 Length:424 Species:Danio rerio


Alignment Length:395 Identity:161/395 - (40%)
Similarity:230/395 - (58%) Gaps:45/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAAHSHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPS-DD 64
            ||...:..|.|      ||.||::.:..:::||.|::|:|||....::.|:.|||:|.||.: |:
Zfish     1 MAHLQNIRNQN------SRLNPEEYFTKLERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDE 59

  Fly    65 IQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRE 129
            |:.|||||.::..|..|.:..||||||...||||.||:.||||..|:.: .|.|.||.||.:.||
Zfish    60 IEDIQQEITVLSQCDSPYVTKYYGSYLTGSKLWIIMEYLGGGSALDLLR-PGTLEEVYIATILRE 123

  Fly   130 TLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAA 194
            .||||:||||..|:|||||.||:||:|:|:||||||||:.|:|.|..||.:|:|||:||||||. 
Zfish   124 ILKGLDYLHSERKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI- 187

  Fly   195 VERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNF 259
              ::..|:...|||:.||||||||:.:||..:|||||.|||:.|:  .||||  :..:|..|.:|
Zfish   188 --KQSAYDFKADIWSLGITAIELAKGEPPNAELHPMRVLFLIPKN--NPPTL--EGSYSKAFKDF 246

  Fly   260 IKTALTKNPKKRPTAERLLQHPFVQCEMSLRVAK------ELLQKYQSPNPQFYYYLDGDEESVA 318
            ::..|.|.|:.||||:.||:|.|:     .|..|      ||:.:|:.      :..:|..|..:
Zfish   247 VEACLNKEPRFRPTAKELLKHKFI-----TRYTKKTSYLSELIDRYRR------WKSEGHGEESS 300

  Fly   319 GVPQRIASKMTSRTNGV--------PAQNHTLKTGMTTNSTWNERSSSPETLPSDMSLLQYID-- 373
            .....:..:...|..|.        |:..:.|..|::...  |:.|...:..|...||..:|.  
Zfish   301 SDDSDMDGEGDDRDQGPMWTFPTVRPSTINKLNRGLSHLD--NKTSDVMKRQPKSSSLTSFITPI 363

  Fly   374 -EELK 377
             :|||
Zfish   364 FKELK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 131/258 (51%)
S_TKc 26..283 CDD:214567 131/257 (51%)
CNH 869..1184 CDD:279162
stk25aXP_005165982.1 STKc_MST3_like 20..291 CDD:270786 137/289 (47%)
S_TKc 20..270 CDD:214567 131/257 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.