DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and Pak3

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster


Alignment Length:287 Identity:111/287 - (38%)
Similarity:168/287 - (58%) Gaps:16/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIA 85
            :|::.|:..|::|.|..|.|:.|..:|:....|:|.|.::......:|..||.:::|..|.|::.
  Fly   288 DPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVN 352

  Fly    86 YYGSYL--RRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIK 148
            :..:||  ..|:||:.||:..||.|.|:...| .:.|.|||.:|||||..:.:||:.|.:|||||
  Fly   353 FLDAYLLEPEDQLWVVMEYMDGGPLTDVVTET-VMKERQIACVCRETLYAISFLHAKGIIHRDIK 416

  Fly   149 GANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGIT 213
            ..|:||...|.||:.|||..|.|... .||::.:||||||||||  |.|| .|.:..|||:.||.
  Fly   417 SDNVLLGMDGSVKVTDFGFCANIEGD-EKRQTMVGTPYWMAPEV--VTRK-KYGKKVDIWSIGIM 477

  Fly   214 AIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLL 278
            |||:.|.|||.....|:|||:|::.:|  .|.:.:.||.||...:|:...|.....:|.||:.||
  Fly   478 AIEMIEGQPPYLYETPLRALYLIAANG--RPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELL 540

  Fly   279 QHPFV-QCE------MSLRVAKELLQK 298
            .|||: .|.      .:::.||::|::
  Fly   541 SHPFLNDCSEVKALVPNIKAAKKVLRR 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 105/259 (41%)
S_TKc 26..283 CDD:214567 105/258 (41%)
CNH 869..1184 CDD:279162
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 106/263 (40%)
S_TKc 293..545 CDD:214567 105/258 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.