DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and stk24b

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_005165890.1 Gene:stk24b / 406786 ZFINID:ZDB-GENE-040426-2841 Length:432 Species:Danio rerio


Alignment Length:304 Identity:139/304 - (45%)
Similarity:197/304 - (64%) Gaps:20/304 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AHSHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPS-DDIQI 67
            |||....::......:.:|::.:..:::||.|::|:|:|....::.::.|||:|.||.: |:|:.
Zfish     2 AHSPVQGSLPGMQNLKADPEELFTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIED 66

  Fly    68 IQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLK 132
            |||||.::..|..|.:..||||||:..||||.||:.||||..|:.: .|.|.|.|||.:.||.||
Zfish    67 IQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGSLDETQIATILREILK 130

  Fly   133 GLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVER 197
            |||||||..|:|||||.||:||:|.|:||||||||:.|:|.|..||.:|:|||:||||||.   :
Zfish   131 GLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI---K 192

  Fly   198 KGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKT 262
            :..|:...|||:.||||||||:.:||..|||||:.|||:.|:  .||||  :..:......|::.
Zfish   193 QSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKN--NPPTL--EGNYCKPLKEFVEA 253

  Fly   263 ALTKNPKKRPTAERLLQHPFVQCEMSLRVAK------ELLQKYQ 300
            .|.|.|..||||:.||:|..:     :|.||      ||:.||:
Zfish   254 CLNKEPSFRPTAKELLKHKLI-----VRFAKKTSYLTELIDKYK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 128/258 (50%)
S_TKc 26..283 CDD:214567 128/257 (50%)
CNH 869..1184 CDD:279162
stk24bXP_005165890.1 STKc_MST3_like 22..295 CDD:270786 135/284 (48%)
S_TKc 24..274 CDD:214567 128/257 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.