DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and Myo3b

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001380706.1 Gene:Myo3b / 366069 RGDID:1560313 Length:1333 Species:Rattus norvegicus


Alignment Length:321 Identity:127/321 - (39%)
Similarity:194/321 - (60%) Gaps:35/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQE 71
            |:|:.||..: |..:|.|.:|:.:.||.||||.|||....:...|||:|::     |.:..:.:|
  Rat    25 HYNSMMLRLE-SLPDPMDTWEIRETIGKGTYGKVYKVANRRDGSLAAVKIL-----DSVNDVDEE 83

  Fly    72 I-----IMMRDCRHPNIIAYYGSYLRRDK-----LWICMEFCGGGSLQDIYQVTG------PLTE 120
            :     |:.....|||::.:||.:.:.|:     ||:.:|.|.|||:.::  |.|      .|.|
  Rat    84 VEAEYNILQFLPSHPNVVKFYGMFYKADRCVGGQLWLVLELCNGGSVTEL--VKGLLRCGKRLDE 146

  Fly   121 VQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTP 185
            ..|:|:...:|.||::||....:|||:||.|||||..|.|||.|||||||:|:|..:|.:.:|||
  Rat   147 ALISYILYGSLLGLQHLHHHRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTP 211

  Fly   186 YWMAPEVAAVERK--GGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNN 248
            :||||||.|.|::  ..|:..||:|:.|||||||.:..||:|::||::.||.:.::  .||||.:
  Rat   212 FWMAPEVIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPRN--PPPTLLH 274

  Fly   249 KDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFVQ------CEMSLRVAKELL-QKYQSP 302
            .|.|...|::||...|.|:.:|||:...||.|||::      ..:..::||.|. ||:|:|
  Rat   275 PDNWCEEFNHFISQCLIKDFEKRPSVTHLLDHPFIKGTQGKVLFLQKQLAKVLWDQKHQNP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 112/275 (41%)
S_TKc 26..283 CDD:214567 112/274 (41%)
CNH 869..1184 CDD:279162
Myo3bNP_001380706.1 MYSc_Myo3 373..1062 CDD:276830
IQ 1102..1124 CDD:197470
PKc_like 20..310 CDD:419665 120/294 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.