DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and Stlk

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster


Alignment Length:347 Identity:94/347 - (27%)
Similarity:152/347 - (43%) Gaps:63/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMR 76
            |.|::||      :|:|::.:.:|..|.||||:.|.:..||..||...:|.:.:.::..|::.:|
  Fly     2 MCSNNIS------DYKLLEILKNGMIGTVYKAEDINNKCLAVKKVSMDQPMEKLTLLFNEVLTVR 60

  Fly    77 DCRHPNIIAYYGSYLRRDKLWICMEF-CGGGS---LQDIYQVTGPLTEVQIAYMCRETLKGLEYL 137
            ..:|.||......:|.:..:::..:| |.|..   |:::|  |....||.||.:.::.|..|.|:
  Fly    61 RLQHRNINTIVSCFLYKQYVYLTYKFMCFGNCEVLLKNVY--TSGFPEVAIALILKDVLSALTYI 123

  Fly   138 HSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTP-------YWMAPEVAAV 195
            ||...:|..::..:|||:....| |::|.......:...|:....|:.       ||.|||| ..
  Fly   124 HSEHYVHGSVRAKHILLSPRKAV-LSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEV-LY 186

  Fly   196 ERKGGYNQLCDIWACGITAIELAELQPPMFDLH-----------PMRALF----LMSKSGFKPPT 245
            :...||.:..||::.|||..|:|....|..|..           .::.|.    |:...|.....
  Fly   187 QNLSGYTEKIDIYSIGITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLE 251

  Fly   246 LNNK---------DKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFV-QCEMS--LRVAKELLQK 298
            ..||         ..:|..||.|::..|.|||..|..|.:|:.|.|: ||..:  |...|:|.||
  Fly   252 HTNKRIARDVIVNKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRNTSLLDQLKDLGQK 316

  Fly   299 YQ---------------SPNPQ 305
            ..               |.|||
  Fly   317 MSKFKRNEHEIFSDARGSHNPQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 78/292 (27%)
S_TKc 26..283 CDD:214567 78/291 (27%)
CNH 869..1184 CDD:279162
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 84/314 (27%)
S_TKc 10..298 CDD:214567 78/291 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.