DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and mbt

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster


Alignment Length:269 Identity:109/269 - (40%)
Similarity:161/269 - (59%) Gaps:8/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHP 81
            :|..:|::..:...|||.|:.|.|..|....:....|:|.:.|......:::..|:::|||..||
  Fly   359 VSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHP 423

  Fly    82 NIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVT-GPLTEVQIAYMCRETLKGLEYLHSMGKMHR 145
            ||:..|.|:|..|:||:.||:..||:|.||  || ..:.|.|||.:|::.||.|.||||.|.:||
  Fly   424 NIVETYSSFLVNDELWVVMEYLEGGALTDI--VTHSRMDEEQIATVCKQCLKALAYLHSQGVIHR 486

  Fly   146 DIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWAC 210
            |||..:|||...|.|||:|||..||::..:.||||.:||||||:|||.:   :..|....|||:.
  Fly   487 DIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVIS---RLPYGPEVDIWSL 548

  Fly   211 GITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAE 275
            ||..||:.:.:||.|:..|::|:..:  ...:||.|.|..|.||...:|:...|.::|.:|.||.
  Fly   549 GIMVIEMVDGEPPFFNEPPLQAMRRI--RDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAA 611

  Fly   276 RLLQHPFVQ 284
            .||.|||::
  Fly   612 ELLAHPFLR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 106/258 (41%)
S_TKc 26..283 CDD:214567 106/257 (41%)
CNH 869..1184 CDD:279162
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 109/266 (41%)
S_TKc 372..619 CDD:214567 106/253 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.