DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and Stk26

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_017457580.1 Gene:Stk26 / 317589 RGDID:1563568 Length:630 Species:Rattus norvegicus


Alignment Length:414 Identity:159/414 - (38%)
Similarity:232/414 - (56%) Gaps:45/414 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAAHSHHNANMLSSDISRRN---PQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPS 62
            :|||...|:...:.....:.|   |::.:..:::||.|::|:|:|....::.::.|||:|.||.:
  Rat   210 VAAASMAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEA 274

  Fly    63 -DDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYM 126
             |:|:.|||||.::..|....:..||||||:..||||.||:.||||..|:.: .||..|.|||.|
  Rat   275 EDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLR-AGPFDEFQIATM 338

  Fly   127 CRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPE 191
            .:|.||||:||||..|:|||||.||:||:|.||||||||||:.|:|.|..||.:|:|||:|||||
  Rat   339 LKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPE 403

  Fly   192 VAAVERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTF 256
            |.   ::..|:...|||:.||||||||:.:||..|:||||.|||:.|:  .||||  ...::.:|
  Rat   404 VI---QQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKN--NPPTL--VGDFTKSF 461

  Fly   257 HNFIKTALTKNPKKRPTAERLLQHPF-VQCEMSLRVAKELLQKYQSPNPQFYYYLDGDEESVAGV 320
            ..||...|.|:|..||||:.||:|.| |:.........||:.:::....:.:    .||||.:  
  Rat   462 KEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGH----SDEESDS-- 520

  Fly   321 PQRIASKMTSRTNGVPAQNHTLKTGMTTNSTWN----ERSSSPETLPSDMSLLQYIDEELKLRAT 381
             :...|:.:||.:             .|:..|:    .:...|:.|.:        .||..|..|
  Rat   521 -EGSDSESSSRES-------------NTHPEWSFTTVRKKPDPKKLQN--------GEEQDLVQT 563

  Fly   382 LPLNNDTKDPLGAECSCSSHNGGA 405
            |...:....|..||......|..:
  Rat   564 LSCLSMIITPAFAELKQQDENNAS 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 130/259 (50%)
S_TKc 26..283 CDD:214567 130/258 (50%)
CNH 869..1184 CDD:279162
Stk26XP_017457580.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.