DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and shk2

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_592864.1 Gene:shk2 / 2541468 PomBaseID:SPAC1F5.09c Length:589 Species:Schizosaccharomyces pombe


Alignment Length:278 Identity:111/278 - (39%)
Similarity:163/278 - (58%) Gaps:12/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNEL-----AAIKVIKLEPSDDIQIIQQE 71
            ||...::..:|.:.:.:..|:|.|..|.||.||.:...:|     .|||.|.|:.....::|..|
pombe   295 MLKDSVTSHDPVEYFNVKHKLGQGASGSVYLAKVVGGKQLGIFDSVAIKSIDLQCQTRKELILNE 359

  Fly    72 IIMMRDCRHPNIIAYYGSYLRRDK-LWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLE 135
            |.:||:..||||:.|..|:|.|:: ||:.||:...|||.||.: ...|||.|||.:|.||.||::
pombe   360 ITVMRESIHPNIVTYLDSFLVRERHLWVVMEYMNAGSLTDIIE-KSKLTEAQIARICLETCKGIQ 423

  Fly   136 YLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGG 200
            :||:...:|||||..|:||...|::|:.|||..|:::...|||.:.:||||||||||.   ::..
pombe   424 HLHARNIIHRDIKSDNVLLDNSGNIKITDFGFCARLSNRTNKRVTMVGTPYWMAPEVV---KQNE 485

  Fly   201 YNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALT 265
            |....|||:.||..||:.|.:||.....|:|||:|::|:|  .|||...:..|....:|:.:.||
pombe   486 YGTKVDIWSLGIMIIEMIENEPPYLREDPIRALYLIAKNG--TPTLKKPNLVSKNLKSFLNSCLT 548

  Fly   266 KNPKKRPTAERLLQHPFV 283
            .:...|.||..||.|.|:
pombe   549 IDTIFRATAAELLTHSFL 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 107/263 (41%)
S_TKc 26..283 CDD:214567 107/262 (41%)
CNH 869..1184 CDD:279162
shk2NP_592864.1 PH_Cla4_Ste20 24..120 CDD:270097
PBD 128..182 CDD:279166
STKc_PAK 308..567 CDD:270789 108/265 (41%)
S_TKc 309..566 CDD:214567 107/262 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.