DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and Pak5

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_006499571.1 Gene:Pak5 / 241656 MGIID:1920334 Length:736 Species:Mus musculus


Alignment Length:284 Identity:108/284 - (38%)
Similarity:163/284 - (57%) Gaps:6/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHP 81
            :|..:|::..:...|||.|:.|.|..|....:.:..|:|.:.|......:::..|:::|||..|.
Mouse   457 VSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHD 521

  Fly    82 NIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRD 146
            |::..|.|||..|:||:.|||..||:|.||...| .:.|.|||.:|...||.|.|||:.|.:|||
Mouse   522 NVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHT-RMNEEQIATVCLSVLKALSYLHNQGVIHRD 585

  Fly   147 IKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACG 211
            ||..:||||..|.:||:|||..||::..:.||||.:||||||||||.:   :..|....|||:.|
Mouse   586 IKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVIS---RLPYGTEVDIWSLG 647

  Fly   212 ITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAER 276
            |..||:.:.:||.|:..|::|:..:..|  .||.:.:..|.|.....|:...|.:.|.:|.||:.
Mouse   648 IMVIEMIDGEPPYFNEPPLQAMRRIRDS--LPPRVKDLHKVSSMLRGFLDLMLVREPSQRATAQE 710

  Fly   277 LLQHPFVQCEMSLRVAKELLQKYQ 300
            ||.|||::..........|:::|:
Mouse   711 LLGHPFLKLAGPPSCIVPLMRQYR 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 103/257 (40%)
S_TKc 26..283 CDD:214567 103/256 (40%)
CNH 869..1184 CDD:279162
Pak5XP_006499571.1 CRIB_PAK_like 26..72 CDD:238526
STKc_PAK5 443..734 CDD:132989 107/282 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.