DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and Pak2

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_796300.1 Gene:Pak2 / 224105 MGIID:1339984 Length:524 Species:Mus musculus


Alignment Length:283 Identity:122/283 - (43%)
Similarity:176/283 - (62%) Gaps:12/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRD 77
            |.:.:|..:|:.:|...:|||.|..|.|:.|..:...:..|||.|.|:.....::|..||::|::
Mouse   236 LRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE 300

  Fly    78 CRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGK 142
            .::|||:.:..|||..|:|::.||:..||||.|:...| .:.|.|||.:|||.|:.||:||:...
Mouse   301 LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTET-CMDEAQIAAVCRECLQALEFLHANQV 364

  Fly   143 MHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDI 207
            :|||||..|:||...|.|||.|||..||||...:||.:.:||||||||||  |.|| .|....||
Mouse   365 IHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV--VTRK-AYGPKVDI 426

  Fly   208 WACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRP 272
            |:.||.|||:.|.:||..:.:|:|||:|::.:|  .|.|.|.:|.||.|.:|:...|..:.:||.
Mouse   427 WSLGIMAIEMVEGEPPYLNENPLRALYLIATNG--TPELQNPEKLSPIFRDFLNRCLEMDVEKRG 489

  Fly   273 TAERLLQHPFVQCEMSLRVAKEL 295
            :|:.||||||      |::||.|
Mouse   490 SAKELLQHPF------LKLAKPL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 114/257 (44%)
S_TKc 26..283 CDD:214567 114/256 (45%)
CNH 869..1184 CDD:279162
Pak2NP_796300.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
Autoregulatory region. /evidence=ECO:0000250 69..137
GTPase-binding. /evidence=ECO:0000250 69..112
PBD 73..127 CDD:334253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..188
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
STKc_PAK2 229..524 CDD:132986 122/283 (43%)
Nuclear localization signal. /evidence=ECO:0000250 245..251 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.