DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and MYO3B

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:XP_011508956.1 Gene:MYO3B / 140469 HGNCID:15576 Length:1386 Species:Homo sapiens


Alignment Length:391 Identity:139/391 - (35%)
Similarity:215/391 - (54%) Gaps:64/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDI-QIIQQ 70
            |:|..||..: |..:|.|.:|:|:.||.||||.|||....:...|||:|:  |:|..|: :.|:.
Human    18 HYNPMMLGLE-SLPDPTDTWEIIETIGKGTYGKVYKVTNKRDGSLAAVKI--LDPVSDMDEEIEA 79

  Fly    71 EIIMMRDC-RHPNIIAYYGSYLRRD-----KLWICMEFCGGGSLQDIYQVTG------PLTEVQI 123
            |..:::.. .|||::.:||.:.:.|     :||:.:|.|.|||:.::  |.|      .|.|..|
Human    80 EYNILQFLPNHPNVVKFYGMFYKADHCVGGQLWLVLELCNGGSVTEL--VKGLLRCGQRLDEAMI 142

  Fly   124 AYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWM 188
            :|:....|.||::||:...:|||:||.|||||..|.|||.|||||||:|:|..:|.:.:|||:||
Human   143 SYILYGALLGLQHLHNNRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTPFWM 207

  Fly   189 APEVAAVERK--GGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDK 251
            ||||.|.|::  ..|:..||:|:.|||||||.:..||:||:||::.||.:.::  .||||.:.:|
Human   208 APEVIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFDMHPVKTLFKIPRN--PPPTLLHPEK 270

  Fly   252 WSPTFHNFIKTALTKNPKKRPTAERLLQHPFVQ------CEMSLRVAKELL-QKYQSPNPQFYYY 309
            |...|::||...|.|:.::||:...||.|||::      ..:..::||.|. ||:|:|       
Human   271 WCEEFNHFISQCLIKDFERRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNP------- 328

  Fly   310 LDGDEESVAGVPQRIASKMTSRTNGVPAQNHTLKTGMTTNSTWNERSSSPETLPSDMSLLQYIDE 374
                          :|.....|              |.|...::...:....|..|:..|:.:||
Human   329 --------------VAKTRHER--------------MHTRRPYHVEDAEKYCLEDDLVNLEVLDE 365

  Fly   375 E 375
            :
Human   366 D 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 115/272 (42%)
S_TKc 26..283 CDD:214567 115/271 (42%)
CNH 869..1184 CDD:279162
MYO3BXP_011508956.1 STKc_myosinIIIB_N 13..303 CDD:270808 123/291 (42%)
S_TKc 36..302 CDD:214567 115/271 (42%)
MYSc 355..1062 CDD:214580 4/12 (33%)
MYSc_Myo3 366..1055 CDD:276830 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.