DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hppy and PAK4

DIOPT Version :9

Sequence 1:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001014831.1 Gene:PAK4 / 10298 HGNCID:16059 Length:591 Species:Homo sapiens


Alignment Length:263 Identity:106/263 - (40%)
Similarity:158/263 - (60%) Gaps:6/263 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIA 85
            :|:...:...|||.|:.|.|..|....|.:|.|:|.:.|......:::..|:::|||.:|.|::.
Human   316 DPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVE 380

  Fly    86 YYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGA 150
            .|.|||..|:||:.|||..||:|.||...| .:.|.|||.:|...|:.|..||:.|.:|||||..
Human   381 MYNSYLVGDELWVVMEFLEGGALTDIVTHT-RMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSD 444

  Fly   151 NILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITAI 215
            :||||..|.|||:|||..||::..:.:|||.:|||||||||:.:   :..|....|||:.||..|
Human   445 SILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELIS---RLPYGPEVDIWSLGIMVI 506

  Fly   216 ELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQH 280
            |:.:.:||.|:..|::|:.::..:  .||.|.|..|.||:...|:...|.::|.:|.||..||:|
Human   507 EMVDGEPPYFNEPPLKAMKMIRDN--LPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKH 569

  Fly   281 PFV 283
            ||:
Human   570 PFL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 104/257 (40%)
S_TKc 26..283 CDD:214567 104/256 (41%)
CNH 869..1184 CDD:279162
PAK4NP_001014831.1 CRIB_PAK_like 10..55 CDD:238526
Linker 25..320 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..301
GEF-interaction domain (GID) 298..323 1/6 (17%)
STKc_PAK4 300..591 CDD:132988 106/263 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.