DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10737 and Prkch

DIOPT Version :9

Sequence 1:NP_001137711.1 Gene:CG10737 / 37202 FlyBaseID:FBgn0034420 Length:955 Species:Drosophila melanogaster
Sequence 2:NP_032882.2 Gene:Prkch / 18755 MGIID:97600 Length:683 Species:Mus musculus


Alignment Length:81 Identity:29/81 - (35%)
Similarity:39/81 - (48%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   850 IKRHFIVPLAIAQRPRWRRKGTKLHIYNDHTFIAKHLSGSGLQCSICMKSIPRRPGKQGYECRDC 914
            |.:||       .|.|.|....::|..|.|.|:|.:|. ....||.|.:.|....|||||:|:.|
Mouse   150 IFKHF-------TRKRQRAMRRRVHQVNGHKFMATYLR-QPTYCSHCREFIWGVFGKQGYQCQVC 206

  Fly   915 QLISHKQCHIRAPQAC 930
            ..:.||:||.....||
Mouse   207 TCVVHKRCHHLIVTAC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10737NP_001137711.1 C2_C21orf25-like 392..515 CDD:176060
C1 879..930 CDD:237996 19/50 (38%)
PrkchNP_032882.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..222 CDD:365894 19/50 (38%)
C1_1 246..296 CDD:365894
STKc_nPKC_eta 359..681 CDD:270742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12328
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.