DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ena and Spred

DIOPT Version :9

Sequence 1:NP_001137709.1 Gene:ena / 37201 FlyBaseID:FBgn0000578 Length:980 Species:Drosophila melanogaster
Sequence 2:NP_001260979.1 Gene:Spred / 36643 FlyBaseID:FBgn0020767 Length:519 Species:Drosophila melanogaster


Alignment Length:214 Identity:59/214 - (27%)
Similarity:103/214 - (48%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 IIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHHQQ------NNTFRVVGRKLQDHEVVINCSI 360
            ::..||.||..|::.:.|:|. :..||:.|.|....:      .:.:.:.|:::.|..|:::|.|
  Fly    10 LVTVRAQVMTRDESTEGWLPL-AGGGLANVSIRKRARLSPLASGHDYIIYGQRISDQSVILSCVI 73

  Fly   361 LKGLKYNQATATFHQWRDSKFVYGLNFSSQNDAENFARAMMHAL-EVLSGRVANNPG---GPPTN 421
            .:.|||.:...|||.||..|...||.|.:..||..|.:.::.|. |::.|...:||.   .|.|.
  Fly    74 NRDLKYYKVMPTFHHWRAGKQRNGLTFQTAADARAFDKGVLRAYNELIDGLAKSNPTIICPPLTK 138

  Fly   422 GNGYEEDMGYRT--MTSEDAAILRQNNSIGGHVTPSAQTPTSQTNQNNIPQSPPTPQGHH----R 480
            .:...||..:.|  :..|..::.:.::|..|    |.::..|.:|.::..:.||.|. |:    :
  Fly   139 YDSVGEDDVFMTLDLPVESESLQKIHSSPEG----SEKSHKSVSNNSDSEKLPPPPI-HYISTDK 198

  Fly   481 TSS------APP---APQP 490
            ||:      |||   ||.|
  Fly   199 TSATTSPPDAPPASAAPSP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enaNP_001137709.1 EVH1_Ena_VASP-like 301..408 CDD:269918 33/112 (29%)
VASP_tetra 945..979 CDD:285929
SpredNP_001260979.1 EVH1_SPRED-like 9..122 CDD:269978 33/112 (29%)
Sprouty 315..413 CDD:282994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11202
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.