DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ena and SPRED1

DIOPT Version :9

Sequence 1:NP_001137709.1 Gene:ena / 37201 FlyBaseID:FBgn0000578 Length:980 Species:Drosophila melanogaster
Sequence 2:XP_005254259.1 Gene:SPRED1 / 161742 HGNCID:20249 Length:456 Species:Homo sapiens


Alignment Length:225 Identity:72/225 - (32%)
Similarity:104/225 - (46%) Gaps:47/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 FAEQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYH--HQQNN---TFRVVGRKLQDHEVVI 356
            |...|....||.||..||:...|:|.| .||||.|.::.  ||:.|   .|.:.|.:|:|..||:
Human    21 FFHNSYARVRAVVMTRDDSSGGWLPLG-GSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVL 84

  Fly   357 NCSILKGLKYNQATATFHQWR--DSKFVYGLNFSSQNDAENFARAMMHALEVLSGRVANNPGGPP 419
            .|.:.|.|.||:.|.|||.|:  |.||  ||.|.|..||..|.|.:..|:|.:|       .|.|
Human    85 ECMLKKDLIYNKVTPTFHHWKIDDKKF--GLTFQSPADARAFDRGIRRAIEDIS-------QGCP 140

  Fly   420 TNGNGYE--EDMGYRTMTSEDAAILRQNNSIGGHVTPSAQTPTSQTNQNNIPQSPPTPQGHHRTS 482
            .:.|..|  :|:   ....||::    ::.:..|:          ..|..:..|.|     :|:|
Human   141 ESKNEAEGADDL---QANEEDSS----SSLVKDHL----------FQQETVVTSEP-----YRSS 183

  Fly   483 SAPPAP----QPQQQQQQQQAQQM--GQPG 506
            :..|:|    ..::...|.||.|:  ||||
Human   184 NIRPSPFEDLNARRVYMQSQANQITFGQPG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enaNP_001137709.1 EVH1_Ena_VASP-like 301..408 CDD:269918 47/113 (42%)
VASP_tetra 945..979 CDD:285929
SPRED1XP_005254259.1 EVH1_SPRED-like 25..137 CDD:269978 48/121 (40%)
Sprouty 345..440 CDD:282994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.