DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and ABHD13

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_116248.2 Gene:ABHD13 / 84945 HGNCID:20293 Length:337 Species:Homo sapiens


Alignment Length:365 Identity:80/365 - (21%)
Similarity:132/365 - (36%) Gaps:112/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLSWLTGLVGLRCLQACLLIFFLIF--VVLPLIFRYSVTFQRGILF------LTFIKYPKGLDLT 78
            |.||...|..:..|.  |::.|.::  ::|.|:...|:.   |||:      |.|.:.|....|.
Human    18 LASWSWALCRISLLP--LIVTFHLYGGIILLLLIFISIA---GILYKFQDVLLYFPEQPSSSRLY 77

  Fly    79 KPESVGLYATRNFYITVKDHDQDEDGVRVGVWHVLPSNAVRRFKRELRVEEEVAQDPDQQLDPAP 143
            .|...|: ...|.:|..|      ||:|:        |.:                         
Human    78 VPMPTGI-PHENIFIRTK------DGIRL--------NLI------------------------- 102

  Fly   144 GNERELKELSPAIRSEFPVVLPENEQLFYERLLRMPG-----GTVVLYLHGNTASRGSGHR-SEV 202
                                           |:|..|     ...::|.|||..:  .||| ...
Human   103 -------------------------------LIRYTGDNSPYSPTIIYFHGNAGN--IGHRLPNA 134

  Fly   203 YKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYI---ANTTSNPIVVWGHSLGTGV 264
            ..:|..|..::...|||||..|:. ..:|||:..|:..|.:|:   .:.....|.::|.|||..|
Human   135 LLMLVNLKVNLLLVDYRGYGKSEG-EASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAV 198

  Fly   265 ATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHPFAKLYKNLPWFNFTISQPMYTNRLRFESD 329
            |.|    |||........:::|:.|.:|     .|..:.|:...|....    |::..:.:|.|.
Human   199 AIH----LASENSHRISAIMVENTFLSI-----PHMASTLFSFFPMRYL----PLWCYKNKFLSY 250

  Fly   330 VHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRT 369
            ..:.:.|.|.:.|....|.::|..:..:||.::   .|||
Human   251 RKISQCRMPSLFISGLSDQLIPPVMMKQLYELS---PSRT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 51/191 (27%)
ABHD13NP_116248.2 FrsA <107..302 CDD:223999 52/200 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.