DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and AT1G32190

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_174498.1 Gene:AT1G32190 / 840111 AraportID:AT1G32190 Length:422 Species:Arabidopsis thaliana


Alignment Length:200 Identity:55/200 - (27%)
Similarity:88/200 - (44%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 FYERLLRMPGGTV-VLYLHGNTASRGSGHRSEVYKLL--RKLNYHV--FSFDYRGYADSDPVPPT 230
            ||   ||.|...: :||.|||.|..|     :::.|.  .|:|..|  ..:||.||..|.. .|:
plant    69 FY---LRNPNARLTLLYSHGNAADLG-----QLFDLFVQLKVNLRVNLMGYDYSGYGASTG-KPS 124

  Fly   231 EEGVVRDAMMVFEYIA---NTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNI 292
            |.....|....:|.:.   ......::::|.|:|:|...||.:||..|     |||:|.|   .|
plant   125 EYDTYADIEAAYECLQTDYGVGQEDLILYGQSVGSGPTLHLASKLPRL-----RGVVLHS---GI 181

  Fly   293 RDEIRMHPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYR 357
            ...:|:....|       |.|........|:::        :.:.|:::||..:|.||.:..|.|
plant   182 LSGLRVLCHVK-------FKFCCDIYSNVNKIK--------KVKCPVLVIHGTEDDVVNWLHGNR 231

  Fly   358 LYRIA 362
            |:::|
plant   232 LWKMA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 49/187 (26%)
AT1G32190NP_174498.1 FrsA 49..269 CDD:223999 54/199 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.