DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and WAV2

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_568395.1 Gene:WAV2 / 832174 AraportID:AT5G20520 Length:308 Species:Arabidopsis thaliana


Alignment Length:233 Identity:62/233 - (26%)
Similarity:109/233 - (46%) Gaps:50/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PAIRSEFPVVLPENEQLFYERL-------LRMPG----------GTVVLYLHGNTASRGSGHRSE 201
            |.:...:|:. |....|.||.:       :|:..          |..:|:...|..:  ..||.|
plant    37 PGLSKSYPIT-PARLNLIYEDIWLQSSDGVRLHAWFIKMFPECRGPTILFFQENAGN--IAHRLE 98

  Fly   202 VYK-LLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTT---SNPIVVWGHSLGT 262
            :.: :::||..:||...||||..|:.. |:::|:::||....::::..|   ::.|||:|.|||.
plant    99 MVRIMIQKLKCNVFMLSYRGYGASEGY-PSQQGIIKDAQAALDHLSGRTDIDTSRIVVFGRSLGG 162

  Fly   263 GVATHLCAKLASLRERAP---RGVILESPFTNIRDEIR-MHPFAKLY------KNLPWFNFTISQ 317
            .|.       |.|.:..|   ..:|||:.||:|.|... :.||.|.:      |:|...||.:..
plant   163 AVG-------AVLTKNNPDKVSALILENTFTSILDMAGVLLPFLKWFIGGSGTKSLKLLNFVVRS 220

  Fly   318 PMYTNRLRFESDVHVLEFRQPIMIIHA-EDDVVVPFNL 354
            |..|      .|. :.|.:||::.:.. :|::|.||::
plant   221 PWKT------IDA-IAEIKQPVLFLSGLQDEMVPPFHM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 54/187 (29%)
WAV2NP_568395.1 FrsA 13..298 CDD:223999 62/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.