DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and AT4G31020

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_194831.3 Gene:AT4G31020 / 829229 AraportID:AT4G31020 Length:294 Species:Arabidopsis thaliana


Alignment Length:234 Identity:61/234 - (26%)
Similarity:95/234 - (40%) Gaps:60/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VLYLHGNTASRGSGHRSEVYKLLR-KLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIAN 247
            :||.|||.|.  .|...|::..|| .|..::.|:||.||..|.. .|:|.....|...|:..:.:
plant    71 LLYSHGNAAD--LGQMVELFIELRAHLRVNIMSYDYSGYGASTG-KPSEFNTYYDIEAVYSCLRS 132

  Fly   248 ---TTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHPFAKLY--KN 307
               .....|:::|.|:|:|...|:.::|..|     |||:|.|.   |...||:     ||  |.
plant   133 DYGIKQEEIILYGQSVGSGPTLHMASRLKRL-----RGVVLHSA---ILSGIRV-----LYPVKM 184

  Fly   308 LPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSGP 372
            ..||:.            |::...:......:::||..:|.:|..:.|.||:.:           
plant   185 TLWFDI------------FKNIDKIRHVNSQVLVIHGTNDEIVDLSHGKRLWEL----------- 226

  Fly   373 VEFHRFGASRKY--------GHKYLCRAPELPGLIQKFV 403
                   |..||        ||..|...||....::|||
plant   227 -------AKEKYDPLWVKGGGHCNLETYPEYIKHLKKFV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 50/202 (25%)
AT4G31020NP_194831.3 FrsA <70..259 CDD:223999 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D691954at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.