DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and AT4G24760

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_194207.1 Gene:AT4G24760 / 828578 AraportID:AT4G24760 Length:365 Species:Arabidopsis thaliana


Alignment Length:285 Identity:76/285 - (26%)
Similarity:110/285 - (38%) Gaps:86/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 ELKELSPAIRSEFPVVLPENEQLFYERL------------LRMP-GGTVVLYLHGNTASRGSGHR 199
            ||..:||         .|..|.:...||            :|.| ..|.:||.|||.|..|    
plant    31 ELFLMSP---------FPHRENVDILRLPTRRGTEIVAMYIRYPMAVTTLLYSHGNAADIG---- 82

  Fly   200 SEVYKLLRKLNYH----VFSFDYRGYADSDPVPPTEEGVVRD---AMMVFEYIANTTSNPIVVWG 257
             ::|:|..:|:.|    :..:||.||..|.. .|||:....|   |....|.........|:::|
plant    83 -QMYELFIELSIHLRVNLMGYDYSGYGQSSG-KPTEQNTYADIEAAYKCLEENYGAKQENIILYG 145

  Fly   258 HSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIR-MHPFAKLYKNLPWFNFTISQPMYT 321
            .|:|:|....|.|:|..|     |..||.||   |...:| |:|..:.|    ||:      :|.
plant   146 QSVGSGPTVDLAARLPRL-----RASILHSP---ILSGLRVMYPVKRTY----WFD------IYK 192

  Fly   322 NRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSGPVEFHRFGASRKY-- 384
            |..:      :...|.|:::||...|.||.|:.|.:|:.:                  ...||  
plant   193 NIDK------ITLVRCPVLVIHGTADDVVDFSHGKQLWEL------------------CQEKYEP 233

  Fly   385 ------GHKYLCRAPELPGLIQKFV 403
                  .|..|...||..|.::|||
plant   234 LWLKGGNHCDLELFPEYIGHLKKFV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 55/205 (27%)
AT4G24760NP_194207.1 FrsA <54..258 CDD:223999 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.