DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and AT3G30380

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_189657.1 Gene:AT3G30380 / 822739 AraportID:AT3G30380 Length:399 Species:Arabidopsis thaliana


Alignment Length:187 Identity:49/187 - (26%)
Similarity:87/187 - (46%) Gaps:40/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VLYLHGNTASRGSGHRSEVYKLLRKLNYH----VFSFDYRGYADSDPVPPTEEGVVRDAMMVFEY 244
            :||.|||.|..|     ::::|..:|:.|    :..:||.||..|.. .|:|:....|...|:..
plant    70 LLYSHGNAADLG-----QMFELFSELSLHLRVNLIGYDYSGYGRSSG-KPSEQNTYSDIEAVYRC 128

  Fly   245 IA---NTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIR-MHPFAKLY 305
            :.   ......::::|.|:|:|....|.::|.:|     |.|:|.|.   |...:| |:|..:.|
plant   129 LEEKYGVKEQDVILYGQSVGSGPTLELASRLPNL-----RAVVLHSA---IASGLRVMYPVKRTY 185

  Fly   306 KNLPWFNFTISQPMYTNRLRFESDVHVLEF-RQPIMIIHAEDDVVVPFNLGYRLYRI 361
                ||:      :|.|       |..:.| :.|:::||...|.||.::.|.:|:.:
plant   186 ----WFD------IYKN-------VEKISFVKCPVLVIHGTSDDVVNWSHGKQLFEL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 49/187 (26%)
AT3G30380NP_189657.1 MhpC 69..260 CDD:223669 49/187 (26%)
Abhydrolase_5 69..241 CDD:289465 49/187 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.