DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and AT3G01690

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_186818.1 Gene:AT3G01690 / 821094 AraportID:AT3G01690 Length:361 Species:Arabidopsis thaliana


Alignment Length:268 Identity:67/268 - (25%)
Similarity:106/268 - (39%) Gaps:83/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LRMPGGT-VVLYLHGNTASRGSGHRSEVYKLLRKLNYH----VFSFDYRGYADSDPVPPTEEGVV 235
            :|.|..| .:||.|||.|..|     ::|:|..:|:.|    :..:||.||..|.. .|:|....
plant    62 VRHPMATSTLLYSHGNAADLG-----QMYELFIELSIHLKVNLMGYDYSGYGQSTG-KPSEHNTY 120

  Fly   236 RDAMMVFEYIANTTSNP---IVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIR 297
            .|...|::.:..|..:.   ::::|.|:|:|....|.::|..|     |.|:|.||   |...:|
plant   121 ADIEAVYKCLEETFGSKQEGVILYGQSVGSGPTLDLASRLPQL-----RAVVLHSP---ILSGLR 177

  Fly   298 -MHPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQ-PIMIIHAEDDVVVPFNLGYRLYR 360
             |:...|.|    ||:      :|.|       :..:.:.. |::|||...|.||..:.|.:|:.
plant   178 VMYSVKKTY----WFD------IYKN-------IDKIPYVDCPVLIIHGTSDEVVDCSHGKQLWE 225

  Fly   361 IALDGRSRTSGPVEFHRFGASRKY--------GHKYLCRAPELPGLIQKFV-------------- 403
            :..|                  ||        .|..|...||....::||:              
plant   226 LCKD------------------KYEPLWVKGGNHCDLEHYPEYIRHLKKFIATVERLPCPRMSSD 272

  Fly   404 --ENYRDA 409
              |..|||
plant   273 QSERVRDA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 52/206 (25%)
AT3G01690NP_186818.1 FrsA <54..261 CDD:223999 63/247 (26%)
PTZ00266 <268..>361 CDD:173502 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.