DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and AT2G24320

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001324569.1 Gene:AT2G24320 / 816968 AraportID:AT2G24320 Length:293 Species:Arabidopsis thaliana


Alignment Length:300 Identity:75/300 - (25%)
Similarity:116/300 - (38%) Gaps:96/300 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PAP----GNERELKELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVV-------------LYLH 188
            |.|    |.:.|..:|.      |..:.|| :.:...:|....|..|:             ||.|
plant    17 PPPTYDVGKDEETGKLM------FTGITPE-KSMDVHQLTTKSGNKVIATFWKHPFSRFTLLYSH 74

  Fly   189 GNTASRGSGHRSEVYKLLRKLNYH----VFSFDYRGYADSDPVPPTEEGVVRDAMMVF-----EY 244
            ||.|..|     ::..|..:|..|    :.|:||.||..|.. .|||.....|...|:     ||
plant    75 GNAADLG-----QMVDLFIELRAHLRVNIMSYDYSGYGASTG-KPTELNTYYDIEAVYNCLRTEY 133

  Fly   245 IANTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIR-MHPFAKLYKNL 308
              ......::::|.|:|:|...||.:::..|     ||::|.|.   |...:| ::|....:   
plant   134 --GIMQEEMILYGQSVGSGPTLHLASRVKRL-----RGIVLHSA---ILSGLRVLYPVKMTF--- 185

  Fly   309 PWFNFTISQPMYTN--RLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSG 371
             ||:      ||.|  ::|     ||   ..|:::||...|.:|..:.|.||:.:|.|       
plant   186 -WFD------MYKNIDKIR-----HV---TCPVLVIHGTKDDIVNMSHGKRLWELAKD------- 228

  Fly   372 PVEFHRFGASRKY--------GHKYLCRAPELPGLIQKFV 403
                       ||        ||..|...||....::||:
plant   229 -----------KYDPLWVKGGGHCNLETYPEYIKHMRKFM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 56/222 (25%)
AT2G24320NP_001324569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D691954at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.