DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Abhd17c

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_598483.2 Gene:Abhd17c / 70178 MGIID:1917428 Length:320 Species:Mus musculus


Alignment Length:258 Identity:60/258 - (23%)
Similarity:96/258 - (37%) Gaps:71/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PDQQLDPAPGNE--------RELKELSPAIRSEFPVVLPENE--QLFYERLLR-----------M 178
            |.....|||..|        ..|.|     |:::.....|.:  ::|:.|..|           .
Mouse    60 PAPAAQPAPAEEGAGPGACSLHLSE-----RADWQYSQRELDAVEVFFSRTARDNRLGCMFVRCA 119

  Fly   179 PGGT-VVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVF 242
            |... .:|:.|||....|. ..|....|..::|.::||:||.||..|.. .|:|:.:..|....:
Mouse   120 PSSRYTLLFSHGNAVDLGQ-MCSFYIGLGSRINCNIFSYDYSGYGVSSG-KPSEKNLYADIDAAW 182

  Fly   243 EYIA---NTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESP--------FTNIRDEI 296
            :.:.   ..:...|:::|.|:|| |.|   ..|||..|.|  .|||.||        |.:.|...
Mouse   183 QALRTRYGVSPENIILYGQSIGT-VPT---VDLASRYECA--AVILHSPLMSGLRVAFPDTRKTY 241

  Fly   297 RMHPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLY 359
            ....|..:.|                         :.:...|:::||..:|.|:.|:.|..:|
Mouse   242 CFDAFPSIDK-------------------------ISKVTSPVLVIHGTEDEVIDFSHGLAMY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 47/188 (25%)
Abhd17cNP_598483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..75 5/14 (36%)
FrsA <125..317 CDD:223999 47/188 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.