powered by:
Protein Alignment CG15111 and acot17
DIOPT Version :9
Sequence 1: | NP_725856.1 |
Gene: | CG15111 / 37200 |
FlyBaseID: | FBgn0034419 |
Length: | 411 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_998412.2 |
Gene: | acot17 / 572757 |
ZFINID: | ZDB-GENE-040426-2381 |
Length: | 438 |
Species: | Danio rerio |
Alignment Length: | 77 |
Identity: | 21/77 - (27%) |
Similarity: | 34/77 - (44%) |
Gaps: | 8/77 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LRSVFLATLIPGTILLSWLTGLVGLRCLQACLLIFFLI--FVVLPLIFRYSVTFQRGILFLTFI- 69
||...:..|.|..|.:|...|.:.....||.||...:. :.:.|.:.|.::. ::|:|...|:
Zfish 106 LRLRKMNVLTPMVINISVYNGHLSQGFSQASLLATTVTERWYMAPGVKRVNIK-EKGVLGTLFLP 169
Fly 70 ----KYPKGLDL 77
.||..|||
Zfish 170 PGSGPYPGVLDL 181
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1073 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.