DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and acot17

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_998412.2 Gene:acot17 / 572757 ZFINID:ZDB-GENE-040426-2381 Length:438 Species:Danio rerio


Alignment Length:77 Identity:21/77 - (27%)
Similarity:34/77 - (44%) Gaps:8/77 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRSVFLATLIPGTILLSWLTGLVGLRCLQACLLIFFLI--FVVLPLIFRYSVTFQRGILFLTFI- 69
            ||...:..|.|..|.:|...|.:.....||.||...:.  :.:.|.:.|.::. ::|:|...|: 
Zfish   106 LRLRKMNVLTPMVINISVYNGHLSQGFSQASLLATTVTERWYMAPGVKRVNIK-EKGVLGTLFLP 169

  Fly    70 ----KYPKGLDL 77
                .||..|||
Zfish   170 PGSGPYPGVLDL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465
acot17NP_998412.2 Bile_Hydr_Trans 29..155 CDD:282610 12/48 (25%)
BAAT_C 219..431 CDD:285986
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.