DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and BAAT

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001121082.1 Gene:BAAT / 570 HGNCID:932 Length:418 Species:Homo sapiens


Alignment Length:362 Identity:78/362 - (21%)
Similarity:117/362 - (32%) Gaps:119/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FRYSVTFQRGILFLTFIKYPKG----LDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGV---- 109
            |:.|:..:.|.:|.:...|...    :||....|:|                   |..:||    
Human    32 FQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLG-------------------GDYMGVHPMG 77

  Fly   110 --WHVLPSNAVRR-FKR----------------ELRVEEEVAQDPDQQLD-----PAPGNERELK 150
              |.:.|...:.| .||                ||.|..:||..|...|.     .|||..| :|
Human    78 LFWSLKPEKLLTRLLKRDVMNRPFQVQVKLYDLELIVNNKVASAPKASLTLERWYVAPGVTR-IK 141

  Fly   151 ELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGHRSEV-YKLLRKLNYHVF 214
            .....:|.  .:.||..|.||       ||   |:.|.|     |.|...|. ..||....:...
Human   142 VREGRLRG--ALFLPPGEGLF-------PG---VIDLFG-----GLGGLLEFRASLLASRGFASL 189

  Fly   215 SFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTSNPIVVWGHSLGT-----GVATHLCAKLAS 274
            :..|..|.|....|...:      :..||..||.......|:|..:|.     ||...|  .:|.
Human   190 ALAYHNYEDLPRKPEVTD------LEYFEEAANFLLRHPKVFGSGVGVVSVCQGVQIGL--SMAI 246

  Fly   275 LRERAPRGVILESPFTNIRDEIRMHPFAKLYKNLPW-FNFTISQPM-YTNRLRFESDVHVLEFRQ 337
            ..::....|::..  ||.       ||     .:|. ::..|.||: ::.:|...:.:.:||.  
Human   247 YLKQVTATVLING--TNF-------PF-----GIPQVYHGQIHQPLPHSAQLISTNALGLLEL-- 295

  Fly   338 PIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSGPVE 374
                              ||.:.....|.|:...|:|
Human   296 ------------------YRTFETTQVGASQYLFPIE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 41/200 (21%)
BAATNP_001121082.1 Bile_Hydr_Trans 14..140 CDD:377407 28/127 (22%)
BAAT_C 207..412 CDD:370148 29/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.