DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and acot18

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001188466.1 Gene:acot18 / 556673 ZFINID:ZDB-GENE-041210-254 Length:472 Species:Danio rerio


Alignment Length:258 Identity:46/258 - (17%)
Similarity:79/258 - (30%) Gaps:83/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 WHVLPSNAVRRFK-RELRVEEEVAQDPDQQLDPAPGNERELKELSPAIRSEFPVVLPENEQLFYE 173
            |::.|  .|:|.. ||..|...:.      |.|.||              .:|.||.        
Zfish   180 WYMAP--GVQRVNIRENGVRGTLF------LPPGPG--------------PYPGVLD-------- 214

  Fly   174 RLLRMPGGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDA 238
              |...||.:|.|.....||.|....:..|          .|.|....||.|      .....:|
Zfish   215 --LWGGGGGLVEYRSALLASHGFASMALEY----------LSPDELRTADVD------VSYFENA 261

  Fly   239 MMVFEYIANTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHPFAK 303
            ..:.:.......|.:.:.|.|.|:.:...:.|....::.:.  .|.:........|:.....|.:
Zfish   262 YQILQNHPKVQKNKMAMLGLSFGSAITFSMAAYSTIIKPQC--CVCISGSHVVPVDKSLFEVFEE 324

  Fly   304 LYKNLPWFNFTISQPMYTNRLRFESDVHVLE-------------------FRQPIMIIHAEDD 347
            :.||:             :::....|.||::                   .:.|:|:::..||
Zfish   325 IKKNM-------------DKVHVNEDNHVIQRGMILPIPSDPAQKIDVGRIKCPVMLVNGGDD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 29/184 (16%)
acot18NP_001188466.1 Bile_Hydr_Trans 63..189 CDD:282610 3/10 (30%)
BAAT_C 253..465 CDD:285986 19/143 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.