DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and acot20

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_696711.3 Gene:acot20 / 553440 ZFINID:ZDB-GENE-041001-182 Length:439 Species:Danio rerio


Alignment Length:198 Identity:45/198 - (22%)
Similarity:70/198 - (35%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RYSVTFQRGILFLTFIKYPKG----LDLTKPESVGLYATRNFYITVKDHDQDEDGVR-VGVWHVL 113
            |..:|.:.|:.|.....|...    :||.:..|:|...|               ||. :|::..|
Zfish    58 RSKITDENGLDFKASATYQADDSGQIDLKRDSSLGGSFT---------------GVEPMGLYWAL 107

  Fly   114 PSNAVR-RF-----KRELRVEEEVAQDPDQQLDPAPGNERELKELSPAIRSEFPVVLPENEQLFY 172
            .::.:. :|     .|...|:.||..| |:.|.... |||..  |:..:|..     |..|....
Zfish   108 KADTISCKFTLSDVTRPALVDIEVVSD-DKVLAKVT-NERHC--LTDGVRRS-----PVTEGRIR 163

  Fly   173 ERLLRMPGGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGY------ADSDPVPPTE 231
            ..|...||......:......||:...... .||.|..:.|.:..::||      ||...:...|
Zfish   164 GTLFMPPGKGPFPGILDTNVFRGAPFELRA-ALLAKRGFAVLALAFQGYQDLPKRADRFHLEYFE 227

  Fly   232 EGV 234
            ||:
Zfish   228 EGI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 13/58 (22%)
acot20XP_696711.3 Bile_Hydr_Trans 40..154 CDD:282610 26/114 (23%)
BAAT_C 221..430 CDD:285986 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.