DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and abhd17b

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001005065.1 Gene:abhd17b / 448619 XenbaseID:XB-GENE-962854 Length:288 Species:Xenopus tropicalis


Alignment Length:198 Identity:48/198 - (24%)
Similarity:80/198 - (40%) Gaps:43/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VLYLHGNTASRGSGHRSEVY-KLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRD---AMMVFEY 244
            :|:.|||...  .|..|..| .|..::|.::||:||.||..|.. .|:|:.:..|   |.:....
 Frog    94 LLFSHGNAVD--LGQMSSFYIGLGSRINCNIFSYDYSGYGSSSG-KPSEKNLYADIDAAWIALRT 155

  Fly   245 IANTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHPFAKLYKNLP 309
            ........::::|.|:||..:..|.|:..|      ..|||.||.|:                  
 Frog   156 RYGIRPEHVIIYGQSIGTVPSVDLAARYES------AAVILHSPLTS------------------ 196

  Fly   310 WFNFTISQPMYTNRLRFESDVH---VLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSG 371
              ...::.|.......|::..:   :.:...|::|||..:|.|:.|:.|..|:       .|...
 Frog   197 --GMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALF-------ERCQR 252

  Fly   372 PVE 374
            |||
 Frog   253 PVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 48/198 (24%)
abhd17bNP_001005065.1 FrsA <93..285 CDD:223999 48/198 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D691954at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.