DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and abhd17c

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001004867.1 Gene:abhd17c / 448170 XenbaseID:XB-GENE-6040893 Length:310 Species:Xenopus tropicalis


Alignment Length:274 Identity:64/274 - (23%)
Similarity:97/274 - (35%) Gaps:86/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 RELRVEEEVAQDPDQQLDPAPG--------------NERELKELSPAIRSEFPVVLPENEQLFYE 173
            ||:......||.|.::....|.              ::|||..:                ::|..
 Frog    45 REMEAPAGTAQPPREEGSGEPAACSLHLSERADWQYSQRELDAV----------------EVFRW 93

  Fly   174 RLLR-----------MPGGT-VVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDP 226
            |..|           .||.. .||:.|||....|. ..|....|..::|.::||:||.||..|..
 Frog    94 RTERGSCLGCMFVRCSPGSRYTVLFSHGNAVDLGQ-MCSFYIGLGTRINCNIFSYDYSGYGVSSG 157

  Fly   227 VPPTEEGVVRDAMMVFEYIA---NTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESP 288
             .|:|:.:..|....:..:.   ..|...|:::|.|:|| |.|   ..|||..|.|  .|||.||
 Frog   158 -KPSEKNLYADIEAAWHALRTRYGVTPENIILYGQSIGT-VPT---VDLASRYECA--AVILHSP 215

  Fly   289 --------FTNIRDEIRMHPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAE 345
                    |.:.|.......|..:.|                         :.:...|::|||..
 Frog   216 LMSGLRVAFPDTRKTYCFDAFPSIDK-------------------------ISKVTSPVLIIHGT 255

  Fly   346 DDVVVPFNLGYRLY 359
            :|.|:.|:.|..:|
 Frog   256 EDEVIDFSHGLAMY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 50/188 (27%)
abhd17cNP_001004867.1 FrsA <115..307 CDD:223999 50/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.