DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15111 and Abhd12b

DIOPT Version :9

Sequence 1:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001382659.1 Gene:Abhd12b / 408202 RGDID:1303145 Length:361 Species:Rattus norvegicus


Alignment Length:345 Identity:110/345 - (31%)
Similarity:168/345 - (48%) Gaps:63/345 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGVWHVLPSNAVRRFKRELRV 127
            :::|.|.|:|..:||.:||: .:..|.||::      :.|.||.:|:||.:||         .|.
  Rat    71 MIYLNFFKFPLLVDLKRPET-KIAHTVNFFL------RSEPGVLLGIWHTVPS---------CRG 119

  Fly   128 EEEVAQDPDQQLDPAPGNERELKELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGNTA 192
            ||            |.|..|                      .:|:..|| .|..:::||||:..
  Rat   120 EE------------AKGKCR----------------------CWYKAALR-DGNPIIVYLHGSAE 149

  Fly   193 SRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTS--NPIVV 255
            .|.:..|.::.::|....:||.|.||||:.||... |||||:..||:.|:|: |.|.|  .|:.:
  Rat   150 HRAAPPRIKLAQVLSDGGFHVLSVDYRGFGDSTGT-PTEEGLTTDAVCVYEW-AKTRSGGTPVCL 212

  Fly   256 WGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHPFAKLYKNLPWFNFTISQPMY 320
            |||||||||||: .|:....:......::||:||||:......:|..|:|:.||....|:.....
  Rat   213 WGHSLGTGVATN-AARALEAKGYPVDAIVLEAPFTNMWVASINYPLLKIYQKLPRCLRTLMDAFK 276

  Fly   321 TNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRS--RTSGPVEFHRFGASRK 383
            .:::.|.:|.:|.....|::|:|.|||..||...|.:||.||   ||  |....|:...|...  
  Rat   277 EDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKQLYEIA---RSAYRNKDRVKMVVFPPG-- 336

  Fly   384 YGHKYLCRAPELPGLIQKFV 403
            |.|..||.:|.|...::.|:
  Rat   337 YHHNLLCESPMLIRSVRDFL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 74/201 (37%)
Abhd12bNP_001382659.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352523
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.